KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2543Help
Entry
XOO_2543          CDS       T00360                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XOO_2543
   00500 Starch and sucrose metabolism
    XOO_2543
Enzymes [BR:xom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     XOO_2543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2833960..2835183
Genome map
AA seq 407 aa AA seqDB search
MTCPTRPFLRERHHMSESHIRTTCLATALLSLVSANAMALTGTATRPQLTTSEASTYTIT
KALAKAGPITALVTDNWNPTAGVALLSADYAVAADGSTPYRTVQAAIDAAVAAGGTTRRY
ISIKAGTYTGLVCVPTNAPPLTVFGLGTDSTDTVIRFNNANPTPKPTGIASHPCASNAAA
TTVGTSNSATLTVRAAGFQARHLRVDNDYVEGTYTDNNQSAVALAVRGDKASFEDVVITG
NQDTLLISATNAANVIRSYFKNSTIEGDVDFIFGSGVGVFDNALIRSAGARLGSSSGGYI
FAPSTRPGSPYGFLAINSRFVAGSGSPDNQTYLGRAWDEGVRGLSAYVNGTSPNGQVTVR
DSNLGSHIRKTAPWDASTASRPYCSSNCTNSANRFYEYGNSGAGAGN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgacctgccccacacgtcccttcctgagagagcgccaccacatgtctgaatcgcacatc
cgtacgacctgcctcgccaccgcactgttgagccttgtcagcgccaatgcgatggcattg
accggcaccgccacgcgaccgcaactcaccactagcgaagcaagcacctacaccatcaca
aaagccttggccaaggccggaccgatcactgcgctggtgaccgacaattggaatcccacg
gcaggcgttgccttgctcagcgccgattacgcagtggctgccgacggctcgacaccctac
cgcaccgtgcaggcggctattgatgcggcggttgctgcaggcggcaccacacgtcgctac
atcagcatcaaggcgggcacctacaccggactggtgtgcgtgcccaccaatgcgccacca
ctgacggtgttcgggctgggcaccgacagcacagatacggtcatccgcttcaacaatgcc
aaccccactcccaaaccgactggcatcgcaagccacccttgcgcaagcaatgcagcggca
accacggtgggcacgtccaatagcgctacgttgacggtgcgcgcagcaggcttccaggcg
cgtcacctgcgcgtggacaacgactatgtcgaaggcacttacacagacaataaccagtcg
gctgtcgcgctggcagtgcgtggtgacaaagccagtttcgaagacgtcgtgatcaccggt
aaccaggacaccttgttgatcagcgcgaccaacgcggccaatgtgatccgctcttacttc
aagaacagcacaatcgagggcgacgtcgatttcatcttcggctcgggtgtcggcgtgttc
gacaatgccctcatccgctccgctggcgcgcgcctgggcagcagcagcggcggctacatc
ttcgcgcccagtacgcgcccgggcagtccctatggttttctcgcgatcaatagccgcttt
gtggctggctcaggctcgcccgacaaccagacctaccttgggcgtgcctgggacgaaggc
gtccgcggcctgtcggcctacgtcaacggcacctcgcccaatgggcaagtgacagtgcgc
gattccaacctgggcagccatattcgcaagaccgcgccgtgggatgcgtccaccgccagc
cgcccgtattgcagcagcaattgcaccaattcggcgaaccgcttttatgagtatgggaac
agcggcgccggcgctgggaattag

DBGET integrated database retrieval system