KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2807Help
Entry
XOO_2807          CDS       T00360                                 

Definition
L-isoaspartate protein carboxylmethyltransferase type II
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3156637..3157314)
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLREAGIHDEATLNAMQTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVTPTKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWHEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGASSQSLVQLTRGADGTIEQQVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaggctgcgcctgcaaccggagtcggtcggaatcggcatgacctcgcagcgc
gtgcgcgaccgcctggtcgaacggctgcgcgaggctggcatccacgacgaggcgacgctc
aacgcgatgcagaccgtgccgcggcacttgttcatcgatgaagcgctggcctcgcgcgcg
tacgaagacaccgcgctgccgatcggccacggccagaccatctcgcagccatgggtggtg
gcgcgcatgaccgaggcagtgctgcaagtgacgccgaccaaggtgctcgaagtgggcacc
ggctccggctaccagggcgcgattctggcggcgctggggctggaggtgtacaccgtcgag
cgcattggcgatctgttacggcaagcgcgcaagcgctttcggcatctgggcatgaacgtg
cgcagcaagcacgacgacggccgtatcggctggcacgagcacggcccctatgacgccatc
gtggtgaccgccgccgcaccggcgctggtcgatgcgctggtcgatcagctggcggtcggt
ggacgcctggtcgctccggtcggcggcgcttcctcgcaatcgctggtgcaactcacacgc
ggcgccgatggcaccatcgaacaacaggttctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system