KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2852Help
Entry
XOO_2852          CDS       T00360                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XOO_2852
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOO_2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3204021..3204413
Genome map
AA seq 130 aa AA seqDB search
MNSPRKLPVLCVPLAGLLLAGALPVPSARAADGAGTFLTECGECHSAKQGKNKKGPSLFG
VAGRPAGTVADFSGYSDALKNSKWTWTPAQLKTYLSHSSTKALPGTKMKYDGLDDPKELD
ALITYLNTLK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaccacgcaagctccccgtgttgtgcgtcccgctggctggtctgttgctggca
ggcgcactgcccgtgccatcggcacgcgctgccgacggtgccggcaccttcctcaccgaa
tgcggcgaatgccatagcgccaaacagggcaaaaacaagaaaggcccgtccctgttcggc
gtggccggccgccctgccggcaccgtggctgatttcagcggttactccgacgcgctcaag
aacagcaagtggacctggaccccggcccagctcaagacctacttgtcgcactcctcgacc
aaggccctgccaggtaccaagatgaagtacgacggcctggacgatccgaaggagctcgac
gcgttgatcacctacctcaacaccttgaagtag

DBGET integrated database retrieval system