KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_2883Help
Entry
XOO_2883          CDS       T00360                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3253496..3254488
Genome map
AA seq 330 aa AA seqDB search
MTQPPSPARPDHRTQRWTPVAIMKVAFASTAFLAMPSMQAAGVAAPSVRPNEPIHVIQPA
TGLDSRKVALGALLFNDRRLSGDNRLACTSCHRLSSNGAAADATTRTPGRAPPALNTPTI
FNATANFRLGWRGNFRSLEVHTASLLEKPSVMQADIATVVGRLRQDTVLNQRFRAAYGRP
PDRAALFDAIASYERSLVTPGSRFDLWLQGSDTALNAQELRGYRTFKSIGCISCHQGVNV
GGNLFQRSGIFAPVTRDGTPILRVPSLRNVATTAPYFHDGSASTLPQAIKAMGTAQLGVA
LSPADVSDIAAFLNTLTGKHQGRQLTAPHP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgccgtcgccggctcggccagaccatcgcacacagcgctggacgccggtg
gcgatcatgaaggtcgcgttcgcttccacagcgttcctcgcgatgccgtccatgcaggca
gctggcgttgcagccccgtcggtgcgccctaatgagcccatccatgtcatccaaccagca
accggcctggacagccgcaaggtcgcgctgggcgcactgctgttcaatgatcgccggctg
tcgggcgataaccgccttgcctgcacgtcttgtcatcgcctgtccagcaacggtgccgct
gccgatgcgacgacccggacgcccgggcgcgcgccgccggcgttaaatacaccgaccatt
ttcaatgcgacagcgaactttcgcctgggctggcgcggcaacttccgcagtctggaagtg
cacacggcttcactgctcgaaaagccaagcgtcatgcaggccgatatcgcgacggtggtc
ggacgactgcgacaagacacggtgctcaatcagcgctttcgcgcggcctatggcaggcca
ccggatcgcgccgcgctgttcgatgccatcgccagctacgaacgctcgctggtcacgccg
ggcagtcgcttcgacctctggctgcaaggcagcgacacggcattgaacgcacaagagtta
cgcggctatcgcaccttcaagtcgatcggctgcatttcctgccaccaaggcgtcaacgtg
ggcggcaatctgttccagcgcagcggcatcttcgctcccgtcacacgggatggcaccccg
atcctgcgggttcccagcctgcgtaacgttgccacgaccgccccgtacttccacgacggc
agcgccagcaccctgccccaggcgatcaaggcgatgggcaccgctcaacttggcgtcgca
ctgagccctgcggatgtctccgatatcgctgcgtttctgaacacattgaccggcaagcac
cagggtcggcagctgacggcgccccacccatga

DBGET integrated database retrieval system