KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3069Help
Entry
XOO_3069          CDS       T00360                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO_3069 (tpiA)
   01230 Biosynthesis of amino acids
    XOO_3069 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_3069 (tpiA)
   00051 Fructose and mannose metabolism
    XOO_3069 (tpiA)
   00562 Inositol phosphate metabolism
    XOO_3069 (tpiA)
Enzymes [BR:xom01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XOO_3069 (tpiA)
Exosome [BR:xom04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XOO_3069 (tpiA)
  Exosomal proteins of bladder cancer cells
   XOO_3069 (tpiA)
  Exosomal proteins of melanoma cells
   XOO_3069 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3481272..3482027)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRAFATELVAKLAAHMPLEGIDVVILPPLPYLGDLIEDFEAHHLSF
GAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHQESSELVARKFAAAIHAGL
TPVLCVGESLEQREAGQTEAILRAQLEPVLALVGSAGFAGAVLAYEPIWAIGTGCTATPE
QAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgccggaaattggaagctgcatggcagccgcgccttcgccacc
gaactggtggccaagctcgccgcgcacatgcccctggagggtatcgacgtcgtcatcctg
ccgccactgccttacctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttc
ggagcccaggacgtcagcagcaatgagaagggcgcctacactggcgaggtctcggcctcg
atgttggtggatgtcggtgccggctacgggctggtcggccactccgagcgccgtcagtac
catcaggagagtagcgagctggtggcgcgcaagttcgccgccgcgatccatgccgggctg
actccggtgctgtgcgtgggcgaatcgctggaacagcgtgaagccggtcagactgaggca
atcctacgtgcccagctcgaaccggtcctggcgctggtcggcagtgccggtttcgcgggc
gccgtgctggcctatgaaccgatctgggccattggcaccggctgtaccgccacgccggag
caggcccaggccgtgcacgccttcctgcgtggcgaagtcgcgaaggcggatgctagaatc
gctgattcgttgcccatcctgtacgggggcagtgtcaagcccgataacgccggcgagctg
tttgcacagcccgatgtcgatggcgggctggtcggaggcgcttcactggtcgccgaagat
ttcctggccatcgcacgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system