KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3079Help
Entry
XOO_3079          CDS       T00360                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO_3079 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOO_3079 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOO_3079 (trpA)
Enzymes [BR:xom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XOO_3079 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3492529..3493335)
Genome map
AA seq 268 aa AA seqDB search
MRRIDFRFAELRANGRKALIPFITAGDPSLEATVPVMHALVRAGADVIELGVPFSDPMAD
GPTIQRSSERALGRGAGLAYVLEAVHEFRREDAATPVVLMGYLNPIEIHGTRRFAEAAVA
AGVDGLLLVDLPPEEADETRAIFTEVGLALIALASPTTSEQRLDMLCSTAQGYLYYVSFA
GVTGASNLLDTHAASDRLRQLRQRAGAPVVAGFGIKDAASAAAMAVDADGVVVGSALVAA
LAEADDVRSARERAEAFLAPLRQALDQA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtatcgatttccgcttcgccgagctgcgtgccaacggtcgcaaggcactgatc
cccttcatcaccgccggcgacccgtcgctggaagccactgtgcccgtcatgcacgcgctg
gtgcgcgccggcgccgatgtcatcgagctcggtgtgccgttctccgacccgatggcggac
ggccccaccatccagcgcagctccgagcgcgcgctgggacgcggtgccggccttgcgtac
gtgttggaagcggtgcacgagttccgccgcgaagacgccgccacgccggtggtgttgatg
ggctacctcaacccgatcgagatccatggcacgcggcgcttcgccgaagcggctgtcgcc
gccggcgtggacggcctgctgctggtcgatctgccgccggaggaagccgatgaaacgcgc
gccatcttcaccgaggtcgggctggcgctgatcgcactggcatcgcccaccaccagtgag
cagcgcctggacatgctgtgcagcactgcgcagggctatctgtattacgtcagttttgct
ggcgtcaccggcgcctccaacctgctcgacacccacgccgccagcgaccgcctgcgccaa
ctgcgtcagcgtgccggcgcgccggtggtggccggcttcggcatcaaggacgccgccagc
gctgccgccatggcggtggatgcggacggcgtggtggtcggcagtgctctggttgccgcc
ctggccgaagccgacgacgtccgcagcgctcgcgaacgcgcagaggccttcctggccccc
ttgcgccaagccctcgaccaagcgtag

DBGET integrated database retrieval system