KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3080Help
Entry
XOO_3080          CDS       T00360                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO_3080
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOO_3080
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOO_3080
Enzymes [BR:xom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XOO_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3493781..3494998)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECLVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGRESRAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHAFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPKDALVLCNLSGRGDKDVHTIAAREGLAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgctggccactttggc
aagtttggcggccggttcgtcgccgaaaccttgattggcccgctgcaggagctgtccgcc
gcctacgatcaagcgcggcaggatccgagcttcatcgccgaatacgacaaggacctcaag
cattacgtcggccgccccagcccgatctaccacgccgaacggctcagccgcgaagtgggc
ggggcgcagatcctgctcaagcgcgaagacctcaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcacggcgtggccagcgccactgtcgctgcacgtctgggcctggaa
tgcctggtctacatgggcgccaccgacatcgaacggcagaagatcaacgtctatcgcatg
aagctgctcggtgcgacggtgatcccggtgacctccggttcggccacgctcaaggacgcg
ctcaacgaagcgatgcgcgactgggtcaccaacgtgcgcgacaccttctacatcatcggc
accgtggccggccctgacccgtatccgcgcatggtgcgcgacttcaacgcgattgtcggc
cgcgagtcgcgcgcgcagatgctggaagactacggccgtctgccggatgcgatcagcgcc
tgcgtcggtggcggtagcaatgcgatcggcctgttccatgccttcctcaacgacccgggc
gtcaagatctatggcgccgaggcggccggcgacggcatcgctaccggccgccatgcggca
tcgatcgccgcagggcgccccggtgtgttgcatggcaatcgcacctatgtgatttgcgac
gacgatggccagatcaccgaaacccattcgatctctgccggcctggattaccccggcgtg
ggtccggagcatgcgtttctgtccgacagcggccgcgcggtgtatcagggcattaccgac
gacgaggcgatggccgcgttccatctgcttgcgcataccgaaggcatcctggccgcactc
gaatccagccatgcggtggcgcagtcgatcaagctcgcgcgcgagctgccgaaagacgcg
ttggtgttgtgcaacctgtctgggcgtggcgacaaggatgtgcataccatcgcggcgcgc
gaggggctcgcgctgtag

DBGET integrated database retrieval system