KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3553Help
Entry
XOO_3553          CDS       T00360                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XOO_3553
Enzymes [BR:xom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     XOO_3553
   3.1.2  Thioester hydrolases
    3.1.2.-  
     XOO_3553
Lipid biosynthesis proteins [BR:xom01004]
 Fatty acid synthase
  Component type
   XOO_3553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4013782..4014450)
Genome map
AA seq 222 aa AA seqDB search
MRNLRMRERTLRYGALSLWLLTLSLLAPGIASAKLPVATAPILVVGDSLSAAHNIPVQSG
WVTLLDQRLKRDMATPPPLVNTSISGETTSGALTRLPGLLEKHHPGVVVIELGGNDALRG
LTPTQLKGNLEKMIQLSQQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYKTALVP
FFLEKVVLQPGLMQADGLHPTAAAQPKVLETVWPALRPLLGS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatctccgaatgcgtgaaagaacactgcgatatggcgcgctgtccctgtggctg
ctgacactctccctgcttgcgccggggattgcctctgccaaacttccggtcgccaccgcg
ccgatcctggtcgtcggcgacagtctgagcgctgcgcacaacatcccggtccagtccggc
tgggtgaccttgctggaccagcgcctgaaacgtgacatggcgacgccacccccgctcgtc
aataccagcatcagcggcgagaccacatccggtgcactgactcgcctgccgggcctgctg
gaaaaacaccatcccggcgtcgtggtgatcgaactcggcggcaacgatgcgctgcgcggc
ctgaccccgacccagctcaagggcaacctggaaaagatgatccagctcagccagcaggcc
ggcgccaaggtgctgctgctggggatcgatgtgccgcccaattacggcccagcctaccgc
gagcggctcaaggcgacctacgccgacctctccaaacagtacaaaaccgcgctggtgccg
ttctttctggagaaggtcgtgttgcagccgggcctgatgcaggccgacggtctgcacccc
actgccgccgcccagccgaaggtactggagacggtgtggccagcgttgcgcccgctgctc
gggtcctaa

DBGET integrated database retrieval system