KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3565Help
Entry
XOO_3565          CDS       T00360                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XOO_3565
Enzymes [BR:xom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XOO_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4027875..4028825
Genome map
AA seq 316 aa AA seqDB search
MSSVVVVGSFNVDHVWRCDALPLPGATIAGRYSTGPGGKGFNQAVAAARAGAKTHFLCAL
GDDAGGALARSLAAQDGFALIAEPSNEPTGTGGIYVDGHGRNTIVIGAGANAVLSPAFID
NQRPLIAAAKVLLAQLESPAETIESALALAHECGVLTVLNAAPANAPTSIGLLKLSDVLT
PNETEFAALLGRHVGERINADNVAALDGNTLHSLCRKLLPGGSVVVTLGAVGAFISHAEE
QLRGDTQAHYRVRAESAQTIDTTGAGDAFNGALVASLAQLPAAGFATHVRFATRYAARST
EVEGAAVSMPRLRADD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggtcgtcgttgtcgggtccttcaatgtcgatcacgtgtggcgctgcgatgca
ttgccactgccaggtgccaccatcgccgggcgctacagcaccggcccaggcggcaagggc
ttcaatcaggcagttgcggctgcacgtgctggcgccaagacgcattttttgtgcgcgctg
ggcgacgatgccgggggtgcgctggcgcggtcgctggccgcgcaggatggttttgcgctg
atcgccgagccgagcaatgaaccgaccggcactggtggcatctatgtcgacgggcacggc
cgcaataccatcgtgatcggtgccggcgccaacgccgtattgagccctgccttcatcgac
aatcagcgtccgctgattgctgcggcgaaggtgctgctggcgcagttggaatcgccggct
gagacgatcgagtcggcactggcgctggcgcacgaatgcggggtgctgaccgtgctcaat
gccgcaccggcaaatgcgccgacctcaatcggcctgcttaaactgtcggatgtgttgacg
cctaacgaaaccgaattcgccgccctgctcggtcgccatgtcggcgaacgcatcaatgcc
gacaatgtcgctgcgctggatggcaatacgctgcattcgctgtgccgcaagttgttgcct
ggtggcagcgtggtcgtcaccctcggcgcggtgggggccttcatttcgcacgccgaagag
caactgcgcggcgacacccaagcgcattatcgggtgcgtgcggaaagcgcacagaccatc
gacaccaccggtgccggcgatgccttcaacggcgcactggtggcatcgcttgcgcagctg
ccggctgcaggcttcgccacccacgtgcgctttgccacgcgttatgcggcccgctccacc
gaagtggaaggcgcggctgtgtcgatgccgcggctgcgcgcagacgactga

DBGET integrated database retrieval system