KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3703Help
Entry
XOO_3703          CDS       T00360                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XOO_3703
  Lipid metabolism
   00600 Sphingolipid metabolism
    XOO_3703
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XOO_3703
Enzymes [BR:xom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XOO_3703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4183307..4186204)
Genome map
AA seq 965 aa AA seqDB search
MRRREFLAGSVCASSLLGVPALVSGAAATTTTTRVGDGAKPRPTSQTAATDAGGQWLDLD
EGWRFHAGDVPFPRLLGQDETYANGKAGQAWGAAAPDFDDTGWRQLQLPHDFVVEQPVRA
DANVAQGYRPRGVAWYRRTFRLEEAVRGQAVELRLDGIASHATVWVNGMLLARSWSGYNG
LVIDITPVARYGNALNSIAIRVDAEAMDGWWYEGGGIYRHTWLVLRAPLHIAGDGLSAMP
REGPGDVWQVPVQLDLVNSGEQPADAWVEVVLRDAHGAVVAQGQTQLRLAAFDTAQAAIS
IAVPQPQRWSVDTPVLYRLQAEVRSADGRSDGAACEVGFRSLRFDADHGFFLNGRPLKIK
GVCLHQDHAGVGVALPDALHVFRLQRLKSMGCNAIRLHHAVAPELLQACDRLGMLVMAEN
RLFNPAPDYVALLRNMVRRQRNHPSVFLWSLLNEEPLQGTATGYAIMARAASAVRALDDT
RPITAAMNDGMFATRGAADVVDVLGFNYRQYNYDRVHAARPRTPMLSSEDTSAFQTRGAW
FTDLDAHVVAEDDSLAADWGNTHRRAWQLIAERPFVAGSFVWTGFDYRGEPTPFEWPSVG
SFFGIMDQCGFAKGAYWLRRVLWIEDAPVLHVLPHWNWPGREGQSIKVMAFCNAEQVELW
LNGRSLGKQAVDRTQSNQWHVDYVPGVLEAVAWRDGHELARTRVETTGAPVALKLTPDRS
ELRGDGRDAQPVTLEAVDAQGRHVPDCNALLTLQISGGRLLGVGNGDPNSHAADQRTQVA
LFNGLAQAIVQAGCSAGVLRLQARSPGLRDAVLEIGCTSAPLPASVPIVAPVMVVESWCH
TAAFAQPPAPDLARRANDNNSWSNTLPGTLESAPERAGHVLYRTQFTPWQGVQTHGGMLD
LGRLSGPAQVFLDGRAVVTAAAGTPIAVALAPAAGERTLAVILQVAADQPFGFHDVVTVH
YRNSP
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggcgtgagttccttgccggcagcgtctgtgcctcgtcgctgcttggcgtgccc
gcgctggtgtctggcgcggcagccaccaccacgaccacgcgtgttggcgatggcgccaag
ccgcgccccacgtcgcagacagcggcgacagatgccggcggccaatggctggatctggac
gaggggtggcgcttccacgccggcgatgtgccgtttccgcgcctgctggggcaggatgag
acgtatgccaatggcaaggcgggccaggcctggggcgcggcggcgccggacttcgacgat
accggttggcggcaactgcaattgccgcacgattttgtggtggagcaaccggtgcgtgca
gacgccaacgtcgcgcagggctatcgcccgcgcggtgtcgcctggtaccggcgcacgttc
cggctggaagaggcagtgcgcggccaggcggtggaactgcgtctggacggtatcgccagc
catgccacggtgtgggtcaacggcatgctgttggcgcgcagttggagcggctacaacggg
ctggtgatcgacatcacgcccgtcgcacgctacggcaatgcactgaacagcatcgccatc
cgcgtcgatgccgaggccatggatgggtggtggtacgaaggcggcggcatctaccgacac
acctggctggtgctgcgcgcgcccctgcatatcgccggcgacggcctgtcagcgatgccg
cgcgaaggcccgggcgatgtctggcaggtgccggtgcagctggaccttgtcaacagtggc
gaacaacccgctgacgcgtgggtcgaggtcgtcttgcgcgatgcgcatggcgctgtcgtg
gcgcaaggtcagacacaactgcggctcgctgccttcgacaccgcacaggcggcgatcagc
atcgcagtgccgcagccgcagcgctggagtgtggacacccccgtgctgtatcgcctgcaa
gccgaggtgcgcagcgcagatggccgcagcgacggtgccgcgtgcgaggttggttttcgt
agcctgcgcttcgacgccgaccacggattttttctcaatgggcgtccgctcaagatcaag
ggcgtctgcctgcatcaggaccatgccggcgtcggcgtggcgctacccgatgcactgcat
gtctttcgtctgcagcggctgaaatcgatgggctgcaatgccatccgcctgcaccacgca
gtggcgccggaactgttgcaggcctgcgaccgtctcggcatgctggtgatggccgaaaac
cgcctgttcaatcctgcgcccgactatgtggcgctgctgcgcaacatggtgcggcgccag
cgcaatcatcccagcgtgtttctgtggtcgctgctcaatgaagagccgctgcagggcacc
gctaccggttacgcgatcatggcgcgcgccgccagcgcagtgcgcgcgctcgacgacacc
cgtccgatcaccgccgcaatgaacgacggcatgttcgccacccgcggcgcggccgatgtg
gtggacgtgctcggtttcaactatcgccagtacaactacgaccgcgtgcatgcggcgcgt
ccgcgcacgccgatgctgtccagcgaagacaccagtgcgtttcagacgcgtggtgcgtgg
ttcaccgatctggacgcgcacgttgtggccgaagacgacagcctggcggcggattggggc
aatacccatcgccgcgcctggcagctgattgccgaacgcccgttcgtcgctggcagtttc
gtatggaccggtttcgattatcgcggcgaacccacaccgttcgaatggccatcggtaggg
tcgttcttcggcatcatggaccaatgcggatttgccaagggcgcctattggttgcgccgc
gtcttatggatcgaggatgcgccggtactgcacgtgttgccgcactggaactggcccggc
cgcgaaggccagtcgatcaaggtgatggcgttctgcaatgccgagcaggtggagctatgg
ctcaacggccgctcgctcgggaaacaggcggtggatcgtacgcaatccaatcaatggcac
gtggattacgtgccgggtgtgcttgaagcggtggcctggcgcgatggacacgaactggcg
cgcacgcgcgtggaaaccaccggcgcgccagtcgcgctcaaactcacccccgaccgcagc
gaactgcgcggcgatggccgcgacgcgcaaccggtgacgttggaggcggtggacgcgcag
gggcgtcacgtgcccgattgcaatgcactgctgaccctgcagatcagtggcggccggttg
ctgggtgtcggcaatggcgacccgaattcgcatgcagcggatcaacgcacgcaggtggcc
ttgttcaatggactggcccaggcaatcgtgcaggccgggtgcagcgcaggcgtgttgcga
ctgcaggcgcgtagcccgggattgcgcgatgcagtgcttgagatcggctgcacgtcggcg
ccgctgccggcgtcggtgccgatcgtggcgccagtgatggtggttgaaagctggtgccac
accgccgcattcgcgcagccgccggcgccggatctcgcgcgccgtgccaacgacaacaac
agctggagcaatacgctgcccggtacgttggaaagcgctcccgaacgtgcaggccatgtg
ttgtatcgcacgcaattcacgccctggcagggcgtgcaaacccacggcggcatgctcgac
ctgggccgcctcagcgggccggcgcaggtatttctggatggccgcgcggtcgtcacggca
gcggccggtacaccgatcgcggtggcgcttgcacccgcagctggcgagcgcacgctcgcg
gtgattctgcaggtcgctgccgatcaaccgtttggattccacgacgtcgtcaccgtgcat
tatcggaactcgccatga

DBGET integrated database retrieval system