KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3789Help
Entry
XOO_3789          CDS       T00360                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO_3789
Enzymes [BR:xom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XOO_3789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4284436..4285896
Genome map
AA seq 486 aa AA seqDB search
MSIFRAANTLALATILALTTPPAFSYSISKNKIVDDKGKVVQLRGVNVSGFESASHVMDG
LWVRNWKEMINQMQGFGFNAVRLPFCPATLRSDTMPSSIDYSRNADLQGLTSLQVLDKVI
NEFNARGMYVLLDHHTPDCASISELWYTGTYSQAQWLNDLRFVANRYKNVPSVIGVDLKN
EPHGAATWGTGNADTDWNKAAERGAAAVLAVAPKWIIAVEGITDNPVCSTNGGIFWGGSL
QPLACTPLNIPANRLLLAPHAYGPDVYVQSYFNDSNFPNNMPAIWDRHFGQFAGNHALLL
GEFGGKYGEGDARDKVWQDALVKYLRSKGINQGFYWPWGPNSVDTGGILRDDWTTVRKDK
MTLLRTLWGTKPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPSASFSTKVIQDSTWNGGY
CNSVQVTNTGTASGTWSISLTVTGTVNNAWNVTWSQSGTTLQASGVDFNRTLAAGATAEF
GYCAAS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcttcagagctgcaaatacacttgcattggcaactatattagcgctaaccacc
cctccggctttcagctattcgatcagcaaaaacaagatcgtcgacgacaaaggcaaagtg
gttcagctcaggggagtcaacgtctccggcttcgagagcgccagccatgtcatggatggc
ctgtgggtacgcaattggaaagagatgatcaaccagatgcagggcttcggcttcaatgcc
gtgcgcctgccgttctgccccgccacgctgcgtagcgacaccatgcccagcagcatcgac
tacagccgcaacgccgacttgcagggcctgacgtcgctgcaggtcctcgacaaggtgatc
aacgaattcaacgcgcgcggcatgtatgtgctgctggatcaccacactcccgattgcgcc
agcatttccgagctgtggtacaccggcacgtattcccaagcgcaatggctgaacgatctg
cgctttgtcgccaatcgctacaagaacgtgccgagcgtgatcggcgtggatctgaagaac
gagccgcacggcgccgctacctggggcaccggcaatgctgacaccgactggaacaaggcc
gccgagcgtggcgcggccgccgtcctggcggtagcgccgaagtggatcattgcggtggaa
ggcatcaccgacaacccggtgtgttcgaccaatggcggcatcttctggggcggcagcctg
cagccgctggcctgcaccccattgaacattccggccaaccgcctgttgctggcaccgcat
gcgtacggcccggatgtctacgtgcaatcgtacttcaacgacagcaacttccccaacaac
atgcccgccatttgggaccgtcacttcggtcagttcgccggtaatcatgcgctgctgctc
ggcgaattcggcggcaagtatggcgaaggcgatgcgcgcgacaaggtgtggcaggacgcg
ctagtgaagtacctgcgtagcaagggcatcaaccaagggttctactggccgtggggcccc
aacagcgtcgacaccggtggcatcctgcgcgacgactggaccacggtgcgcaaagacaag
atgaccctgctgcggacgctatggggcaccaaaccgacaccgacaccgacaccgacaccg
acaccgacaccgacaccaacgccaaccccaacgccaacgccaacgccaacgccgacacca
acgccgagcgctagcttcagcaccaaggtgatccaggacagcacgtggaacggtggctac
tgcaacagcgtgcaagtcaccaataccggcaccgccagcggcacgtggtcgatctcgctg
acggtcaccggcacagtcaacaatgcctggaatgtcacctggtcgcagagcggtaccacg
ctgcaggcaagcggcgttgacttcaaccgcaccctggctgccggtgcaacggccgagttc
ggctactgcgcggcaagctga

DBGET integrated database retrieval system