KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3862Help
Entry
XOO_3862          CDS       T00360                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XOO_3862
Enzymes [BR:xom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XOO_3862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4366183..4366959)
Genome map
AA seq 258 aa AA seqDB search
MTGLAHPDAAWTLISLRPSGEHAPLRRAVARHGGRVLALSPWRLQTNDAAQARDALRQAL
AAPIAVFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALQACGIDTVVRPTRMDSEGL
LALPLLQAPLQAVGLITAPGGRGMLAPTLEQRGARIVRADVYQRIPLRLRASAIQALSHA
LPRSVLALSSAEALTLVLQQLPSALIEKWQRRPVVASSDRMLDAAHAAGFIHRMRAEGPL
PKQLAAAAAAIVTPPRPC
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccttgcccatcccgatgctgcctggaccctgatctcgctgcgccccagcggc
gaacatgcgccgctacggcgggcggttgcgcggcatggcgggcgggtactggcgctgtcg
ccgtggcgcttgcagaccaacgatgccgcacaggcgcgggacgcgctgcgacaggcgctg
gcagcaccgattgcggtgttcaccagcccggcggccgtgcaggcggcgcatcgtctggcg
ccgctgcagcgcccggcgcaggcgcactgggtgagcgtgggcgatggcactgcgcgcgca
ttgcaggcctgcggcatcgacactgtggtgcgcccgacgcgcatggatagcgaaggcctg
cttgcgctgccgctgctgcaggcgccgctgcaggccgttgggctgatcaccgcgcccggc
ggacgcggcatgctggcaccaacgctggaacagcgcggtgcgcgcattgtgcgagccgat
gtctatcaacgcatcccgctgcgcttgcgcgcgtcggccatccaggccttatcgcacgca
ttgccgcgcagcgtgctggccttgagcagcgccgaggcactgacgctggtcctacaacag
ctgccttccgcgctgatcgagaaatggcaacggcggccggtggtcgcgtccagcgatcgc
atgctggatgccgcgcacgctgctggcttcatccatcgcatgcgtgcagaaggcccactg
ccaaagcagcttgccgctgctgcggcagcgatcgtgacaccaccgcgaccttgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system