KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_3910Help
Entry
XOO_3910          CDS       T00360                                 

Definition
disulfide-isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Brite
Enzymes [BR:xom01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XOO_3910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4410025..4411605
Genome map
AA seq 526 aa AA seqDB search
MTLSLRRPSPSSLALLAVLSMLTACDKPAPPAAPSQTHAASTPAPATSIAWREGDVEDAF
AEAKESGKPILLYWGAAWCPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGER
FGVKAYPTIIVLRTDQSEITRLAGDADNARLAEVLRVAAKSTSTAQQLLDKALHTPQQLS
ADDWAVLGNYAWGTDDRLVKPGDAAHVLTQLSTTAPQPALQRSFALAAISAAEHPPAASA
ANRALLEAVLANPAEVRTNLSPLSYVPARLITAASNDAGVRTTLSNALNQALDKVYADTS
LPISDRLGTAYARIQLARLAQGQPTEAETEGPQPPLPKDVVDTVHQRVTWATDTAKTDEE
RQSTISTAAALLSDVGDGSGAEQLLLAELPRSRTPYYYMPELANLAEQRGDKKTALSWLK
KAYDSAQGPATRVQWGVMYVNGLIRLSPDDTAGIESAATQVIGELAGQPDGYRQRTRQRF
ASLGTTLKTWSKQHRQEGSAVLARLQQKMHSSCNSKNASECASWLS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgtcgcttcgacgcccctccccgtcctcgctcgcgctgctggcggtgctgtcc
atgctcactgcctgcgacaagcccgccccgcctgcggcgccttcacagacccacgcggca
tccacaccggcgcctgctaccagcatcgcctggcgcgagggcgacgtggaagatgccttt
gccgaagccaaggaaagcggcaagccgattctgttgtactggggcgcggcgtggtgcccg
ccctgcaaccgcctcaaggcaacgctgttcaaggacccggccttcatcgcgcgcacccag
cagtttgtcgccgtgcacctggatggtgattccgaaggcgcgcaggcctggggcgagcgc
ttcggggtcaaggcctatcccaccatcatcgtgctacgcacggaccagagcgaaatcacc
cgtctggccggcgatgccgataatgcgcgcctggccgaggtgctgcgggtcgccgcaaag
agcaccagcaccgcccagcaattgctcgacaaggcgctgcatacgccacaacagctcagc
gccgacgactgggccgtgctcggcaactatgcctggggcaccgacgaccggctggtcaaa
cccggtgatgccgcccacgtgctcacccagctgtcgacaacggcaccacagccggcgctg
caacgtagcttcgccctggccgccatcagcgccgccgagcacccaccggccgccagcgcc
gccaatcgcgccttgctggaagcggtgttggccaacccggcagaagtgcgcaccaatctc
agtccgctgagctatgtgcccgcgcgtctgatcaccgccgccagcaacgatgccggcgtg
cgtaccacgctctccaatgcgttgaatcaagccttggacaaggtgtacgccgatacgtcg
ttgccgatttccgaccggcttggcaccgcatatgcgcgcatccagctggcacgtctggca
caaggccagcccaccgaagccgaaaccgaaggcccgcaaccaccgttgccgaaagacgtc
gtggacaccgtgcatcagcgcgttacgtgggccaccgacacagccaagaccgacgaggag
cgccaatccaccatcagcacggctgccgcattgctgagcgatgtaggcgatggcagcgga
gccgagcaattgctgttggccgagttgccgcgcagcaggacgccgtattactacatgccc
gagctggcgaatctggccgagcaacgtggcgacaagaagaccgcgctgtcgtggctcaag
aaggcctatgacagcgcacaaggccctgccacgcgcgtgcagtggggcgtgatgtatgtc
aatggtctaatccggctcagccccgacgacactgccggcatcgagagcgccgccacgcag
gtgatcggcgagctggccggccaaccggatggttaccggcaacgcacacgtcagcgcttc
gcctcgcttggcaccacattgaagacctggagcaagcagcaccgtcaggaaggcagtgca
gtactggcgcgcctgcaacagaaaatgcactccagctgcaacagcaagaacgccagcgaa
tgcgccagctggttgagttga

DBGET integrated database retrieval system