KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_4160Help
Entry
XOO_4160          CDS       T00360                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XOO_4160
   00051 Fructose and mannose metabolism
    XOO_4160
Enzymes [BR:xom01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     XOO_4160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4698194..4699531
Genome map
AA seq 445 aa AA seqDB search
MSNTVYIGAKEYFPGIGKIGFEGRESDNPLAFKVYDANKTIGDKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGNSALARAEAKSDAAFEFFTKLGVPYYCFHDIDLSPDADDI
GEYESNLKHMVGVAKQRQADTGIKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRSIGFTGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVANALLTSSPLEQWRAERYASFDNGTGADFAAGKITLADLAAHA
AGNAPKQISGRQEAYENLINQYLTR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgtctacatcggcgcgaaagaatatttccccggcatcggcaagatcggt
ttcgaaggccgcgagtcggacaacccgctcgcgttcaaggtctacgatgccaacaagacc
attggcgacaagaccatggccgagcatctgcgctttgccgtggcctactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggtacgcgtgcgtatccgtgggatgtgggc
aacagcgcgctggcgcgggctgaagccaaatccgatgccgcgttcgagttcttcaccaag
ctcggcgtgccgtactactgcttccacgacatcgacctgtcgccggatgccgatgacatc
ggcgaatacgagagcaacctcaagcacatggtgggtgttgccaagcagcgtcaggccgac
accggcatcaagctgctgtggggcacggccaatctgttctcgcatccgcgctacatgaat
ggtgcctcgaccaacccggacttcaacgtcgtcgcgcgtgcggcggtgcaggtcaaggcc
gcgatcgatgccacggtggagctgggcggcgaaaactacgtgttctggggcggccgcgaa
ggctatgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcggttc
ctcaccctggcgcgcgactacggccgcagcatcggcttcaccggcaacttcctgatcgag
ccaaaacccatggagccgatgaagcatcagtacgattttgatagcgcgaccgtgatcggt
ttcctgcgtcagcacggtctggatcaggacttcaagctcaacatcgaagccaaccacgcc
accttgtccggccatagcttcgagcatgacctgcaggtcgcctccgatgccggcctgctg
ggcagcatcgatgccaaccgcggcaacccgcagaacggttgggataccgaccagttcccg
accgatctgtacgacaccgttggtgcgatgctggtagtgctgcgtcagggtggcttggca
ccgggggggttgaacttcgatgccaaggtgcgtcgcgaatcgtccgatccgcaggacctg
ttcctggcgcacatcggcggcatggacgcgttcgcacgcgggctggaagtggccaatgca
ctgctgacgtcctcgccgttggagcagtggcgcgccgaacgttatgccagcttcgacaat
ggtaccggcgccgactttgccgcaggcaagatcacgctggcggatctggccgcacatgcc
gccggcaatgcgcccaagcagatcagcggccgccaggaagcgtacgaaaacttgatcaat
cagtatctgacgcgttga

DBGET integrated database retrieval system