KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_4171Help
Entry
XOO_4171          CDS       T00360                                 

Definition
secreted xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4716259..4717236)
Genome map
AA seq 325 aa AA seqDB search
MLKLRYPLTLVLLLGACASAVAGPIAAGKRRVLGSAYSPQQAQGFTNYWNADVPENAGKW
GSVEAVRGQMNWGPLDEAYQLAKRNHMQFQFHVGLWGSQQPTWVRDLPPNEQRAAIEHWF
AAIAQRYPDIDLMQVANETLPGHNQPDNRRADSGNYMRALGGTGATGVDWVLEAFRLARK
YFPHTKLMINDYNVTEYNDQARQYLHTIQLLQQEHLIDAIGIQGHLSSNGPSVAVQRANL
DLLASTRLPIYITEFDLDGRTDAQQLAAWQRFFPMFWEHPAVRGVNLWGFRHGMWRDNEG
AYLINYDGSERPALTWLRSYVASRP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactccgttacccgctcacgcttgtgctgttgctgggcgcttgtgcgtccgct
gttgccgggcctatcgctgccggcaaacgacgcgttctgggcagcgcctacagcccacag
caagcgcagggcttcaccaactactggaacgccgacgttcccgaaaatgccggcaaatgg
ggcagcgtcgaagccgtgcgcggccagatgaactggggcccgctcgacgaggcttaccag
ctggccaagcgtaaccatatgcagttccagttccatgtcgggctctggggctcgcagcag
ccgacgtgggtacgcgacctgccgccgaatgaacagcgtgctgcaatcgagcactggttc
gccgccatcgcgcagcgctatcccgatatcgatttgatgcaggtggccaatgagacgctg
ccgggtcacaaccagccggacaatcgccgcgccgattcgggcaattacatgcgggcactg
ggcggtaccggggcgaccggcgtggactgggtgcttgaggcattccgcctggcacgcaag
tatttcccccataccaagttgatgatcaacgactacaacgtcaccgagtacaacgaccaa
gccaggcagtatctgcacaccatccagctgttgcagcaagaacatctgatcgatgcgatc
ggtatccaggggcacctctcgagcaacggcccctcagttgcggtgcagcgcgccaacctc
gacctgctggcatccaccaggttgccgatctacatcaccgagtttgacctggatggccgt
accgatgcccagcagctggcagcctggcagcgcttcttcccgatgttctgggagcacccg
gccgtgcgcggtgtgaacctgtggggtttccgtcacggtatgtggcgcgacaacgaaggt
gcctatctgattaattatgatggcagcgaacgcccggcattgacctggctacgcagctac
gttgccagcaggccatga

DBGET integrated database retrieval system