KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_4231Help
Entry
XOO_4231          CDS       T00360                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XOO_4231
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO_4231
  Lipid metabolism
   00071 Fatty acid degradation
    XOO_4231
  Amino acid metabolism
   00350 Tyrosine metabolism
    XOO_4231
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XOO_4231
   00626 Naphthalene degradation
    XOO_4231
Enzymes [BR:xom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XOO_4231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4783346..4783942)
Genome map
AA seq 198 aa AA seqDB search
MSRRWHRPQSPPGTPEVARIKAGDLVLCLGTVGVSMAALELAKRHGAHVAITSSSDEKLE
LARRLGADITVTYRTDPDWADAVTQLSGGGADVIIETGGQDTLGQSIKVAAANATIVVIG
VTPGTSSPIPDYVSLIRKNATIRGIANASRAMFVDLLRAIEQHRIKTLHNNTFRFDEAPQ
AFDYVARAQHVGKVLIQF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcgctggcatcggccgcagtcaccgcctggcacgccggaagtcgccaggatc
aaggccggcgacctagtgctctgtctgggaaccgtcggcgtctcgatggccgcgctcgaa
ctcgccaagcgccacggtgcccatgtcgccatcacctcatccagcgacgagaagcttgaa
ctcgcgcgccgcctgggcgccgacatcaccgtcacctatcgcaccgatcccgactgggcc
gatgccgtgacgcagctgtccggcggcggcgcggacgtcatcatcgagaccggcgggcag
gacaccctgggacagtcgatcaaggtggcagctgccaacgcgaccatcgtggtgatcggc
gtcactcccggcacctcttcgccgattcccgactatgtgtcgttgatccgcaagaacgca
accattcgcgggatcgccaatgcaagccgggcgatgttcgtggacctgctgcgtgcgatc
gagcagcaccgcatcaagaccctgcacaacaacacgttccggttcgatgaggcgccccag
gcctttgattacgtcgccagggcgcaacacgtgggcaaggtcctgatccagttctga

DBGET integrated database retrieval system