KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_4291Help
Entry
XOO_4291          CDS       T00360                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XOO_4291
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XOO_4291
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOO_4291
Enzymes [BR:xom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XOO_4291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4850111..4851739)
Genome map
AA seq 542 aa AA seqDB search
MPAIDPSAASPLPDSVARLAPPDPSRRRILLAGASLAAAGLLSPFARASGTADPFTLGVA
AGDPLADGFVIWTRLAPRPLDPDGRGGLRAAVPVRWQVASDPQMRTIVRQGETVASPAWG
HAVHVELTGLAADRPYWYCFEALGARSQIGSARSLPAAHQMSDTARFGFVSCSHWELGYF
SAYRHLAAEQPDLVFFLGDYIYEYSNHGAAANKVVRPHGSGECLDLAGYRNRYALYRTDP
DLQALHAGSACVATWDDHEVQNDYANRWSQDPSIPVDTFLARRAAAYRAFYEHFPLRARH
RPHGADMRIYRSLDYGQLARFYVLDGRQYRSEQPCPQANGWRGGHVVADSCRERTDPRRT
MLGWEQERWLQGGFARSPARWNVIAQDLLVAPMRQSGRDGVVGHWTDGWDGYPATRERML
AAIAKTRLRNPVFWGGDIHSYWVTDLKADPADDASATLATEFVGTSITSDGQSNVELHAT
MAANPHVHYVDGETRGYVSVTVTPGQMETRLQGISDRRDRNATVSTTKRFVVQDGRPGAV
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgatcgacccgtctgccgcctcacccctgcccgattccgttgccagactggct
ccaccggatcctagccggcggcgcatcctactcgctggcgccagtctggccgcggcaggg
ctgctgagccccttcgcacgcgctagcggtactgccgacccgttcacgctgggggtggcg
gccggcgatccgttggccgatggctttgtgatctggacgcggctggcaccccgcccgctg
gacccggacggacgcggtggactgcgcgcagcggtgccggtgcgttggcaggtggccagc
gacccgcagatgcgcaccatcgtgcgccagggcgagaccgttgccagccccgcctggggc
catgcggtgcacgtggagctgaccggtctggcggccgatcgcccttactggtactgcttt
gaggcactgggcgcgcgcagccagatcggtagcgcgcgtagcttgccggcagcgcatcag
atgtcggacacggcgcggttcggctttgtctcctgctcgcactgggagctggggtatttc
agcgcgtaccgccacctcgccgcggagcagccggacctggtgttcttcctgggcgattac
atctacgagtacagcaaccacggcgcagcggcgaacaaggtcgtacgcccgcacggcagc
ggcgagtgcctggatctggctggctaccgcaaccgctacgccctctaccgcaccgacccg
gacctgcaagcgctgcatgccggcagtgcctgcgtggcgacctgggacgaccacgaggta
cagaacgattacgccaaccgctggtcgcaggacccgtcgattccggtcgacaccttcctg
gcacggcgcgctgccgcctatcgcgccttttacgaacatttcccgctgcgggcccggcat
cgcccgcatggtgccgacatgcgcatctaccgctcgctggattacggccagctggcgcgt
ttctacgtgctcgatggccgccagtaccgcagcgagcaaccctgcccgcaagccaatggc
tggcgcggcgggcatgtggtggccgacagttgccgcgagcgtaccgacccgcgtcgcacc
atgctcggttgggagcaggagcgctggctgcagggcggcttcgcacggtcgccggcgcgc
tggaatgtcattgcgcaggatctgctggtggcaccgatgcgccaatccggtcgcgatggc
gtcgtcggccactggaccgacggctgggacggctacccggccacgcgcgagcgcatgctc
gctgcgattgcgaagacgcgcttgcgcaaccccgtgttctggggaggcgacatccactcg
tattgggtcaccgacctgaaggccgatccggccgacgacgcgtcggcaacgctggccacc
gagttcgtcggcacctcgatcacctccgacggccagagcaatgtcgaactgcacgcgacg
atggcagccaacccgcacgtgcactacgtggacggcgaaacgcgcggctatgtgtcggtg
acggtcacgccgggccagatggaaacgcggctgcaaggcatctccgatcggcgcgaccgc
aacgcgacagtgtcgacgacgaaacgcttcgtggtgcaagacggcaggcccggtgcagtg
gaggcctga

DBGET integrated database retrieval system