KEGG   Xanthomonas oryzae pv. oryzae MAFF311018: XOO_4312Help
Entry
XOO_4312          CDS       T00360                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF311018
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xom00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XOO_4312
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOO_4312
Enzymes [BR:xom01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XOO_4312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4874191..4874736
Genome map
AA seq 181 aa AA seqDB search
MNQTLYDIPVTRIEGGPATLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEV
LAFPANDFNGQEPGSEAEIAQFCRLTYDVTFPMFAKIAVTGEQAHPLYQALTSTHPHTTG
DGPMREKLAGYGIAPNPAPGVLWNFEKFLIGRDGKIIDRFAPDIPADDARLLQAIDAALV
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacgctgtacgacattccggtgacccgcatcgaaggcggtccggccaccttg
gccgactaccgcggcaaggtgttgctggtggtcaacgtcgcctccaagtgcggcctgacc
ccgcagtacgaagggctggaagcgctgtatcgcgacaagcgcgcacagggcctggaagta
ctggcgtttccggccaacgacttcaacggccaggagccaggcagcgaagcggagatcgcg
cagttctgccggctcacctacgatgtcacctttccgatgtttgccaagatcgccgtcacc
ggcgagcaggcgcatccgctgtatcaggcactgaccagcacgcatccgcacaccaccggc
gacggcccgatgcgggaaaaactggccggctacggcatcgcccccaaccccgcgcccggc
gtgttgtggaacttcgaaaaattcctgatcggccgcgacggcaagatcatcgaccgcttc
gccccggatatccccgccgacgatgcacgcctgcttcaggcaatcgacgcggcgttggtg
gtttaa

DBGET integrated database retrieval system