KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0113Help
Entry
XOO0113           CDS       T00235                                 

Gene name
glgB2
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xoo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
107066..109252
Genome map
AA seq 728 aa AA seqDB search
MTTEGISEMSQTLQALADGLPVDAFAVLGPHPLADGRRQVRVLAPGAEAMGLIDSRGKLL
ARMQASAIDGVFEGILSIEGPYRLRIVWPDMVQEIEDPYAFAVTLDESLLLQIAAGDGQA
LRRALGAQHVQCGEVPGVRFAVWAPHAQRVAVVGDFNGWDVRRHPMRQRIGGFWELFLPR
VEAGPRYKYAVTAADGRVLLKADPVARQTELPPATASVVPGTDTFAWTDAAWMAKRDPSA
VPAPLSIYEVHAASWRRDGHNQPLDWPTLAEQLIPYVQQLRFTHIELLPITEHPFGGSWG
YQPLGLYAPTARHGSPDGFAQFVDACHRAGIGVILDWVSAHFPDDAHGLAQFDGAALYEH
ADPREGMHRDWNTLIYNYGRPEVTAYLLGSALEWIDHYHLDGLRVDAVASMLYRDYGRAE
GEWVPNAHGGRENLEAVAFLRQLNREIAAHFPGVLTIAEESTAWPGVTAAISDGGLGFTH
KWNMGWMHDTLSYMQRDPAERAHHHSQLTFGLVYAFDERFVLPISHDEVVHGTGGLLGQM
PGDDWRRFANLRAYLALMWAHPGDKLLFMGAEFGQWADWNHDQSLDWHLLEGARHRGVQL
LVGDLNATLRRTPALYRGTHRAKGFDWSVADDARNSVLAFIRHDPDGGGVPLLAVSNLTA
QPLHDYGVGVPRAGAWREILNTDSAHYGGSNLGNSGRLATEPMGMHGHAQRLRLTLPPLA
TIYLQAEK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggaagggatctcggagatgtcgcagaccctgcaagcgctggccgatggattg
ccggtcgacgcctttgcggtccttgggccgcacccgctcgccgatgggcgccgccaagtg
cgtgtgctggcgccgggggccgaggcgatggggttgatcgactcgcgcggcaagttgctg
gcacgcatgcaggctagcgcgattgacggcgtctttgaaggcatcctgtcgatcgaaggg
ccgtaccggctgcgcatcgtgtggccggacatggtgcaggagatcgaagacccgtacgcg
ttcgcggtcacactggacgaatcgctgttgctgcagatcgccgctggcgatggtcaggcg
ctgcgccgcgcgctgggcgcgcagcatgtgcaatgtggcgaagtgcccggcgtgcgcttt
gcagtgtgggcaccgcatgcgcaacgcgtggccgtggttggtgacttcaatggctgggac
gtgcggcggcacccgatgcgccagcgtatcggcggcttctgggaactgtttctgccgcgc
gtggaagctggcccgcgctacaagtacgccgtcactgcagccgatggccgcgtgctgctc
aaggccgacccggtggcgcggcaaaccgaattaccgccggccaccgcctcggtggtgccc
ggcacggacacctttgcgtggaccgacgcggcctggatggccaagcgcgatcccagcgcc
gtgccggcgccgctgtcgatctacgaagtgcatgccgcgtcctggcgccgcgacggacat
aaccagccgctggactggccaaccctggccgagcaactgattccctacgtgcagcagctc
cgcttcacccatatcgaattgctgccgatcaccgagcacccgttcggcggttcctggggc
taccagccgctgggcctgtatgcgcccaccgcccgccacggcagcccggacgggtttgcg
cagttcgtcgacgcctgccaccgcgctggcatcggcgtgatcctggactgggtcagcgcg
cacttccccgatgacgcgcatgggctggcgcagttcgacggcgccgcgctgtatgagcac
gccgaccctcgggaaggcatgcatcgcgactggaacaccctgatctacaactacggccgg
ccggaagtgaccgcctacctgctggggagcgcgctggagtggatcgaccattaccatctc
gacggcctgcgcgtggatgcggtggcctcgatgctgtaccgcgactacggccgcgccgaa
ggcgagtgggtgcccaacgcgcatggcggccgcgagaatctagaggcagtggcgttcctg
cgtcagctcaaccgcgagatcgccgcacacttccccggcgtgctcaccatcgccgaagaa
tccaccgcctggccgggcgtgaccgcggcgatcagcgatggcggcctgggcttcacgcac
aaatggaacatgggctggatgcacgacacgctgagctatatgcagcgcgatccagccgaa
cgtgcgcatcaccatagccagctcaccttcgggctggtgtacgcattcgacgagcggttc
gtcttacccatctcgcacgatgaagtggtgcacggcaccggtggcttgctcgggcagatg
ccgggcgacgactggcgccgcttcgccaacctgcgcgcgtatctggcgctgatgtgggcg
cacccgggcgacaaactgctgttcatgggcgccgaattcggtcaatgggccgattggaat
catgaccagtcgctggattggcatctgcttgaaggcgcgcgccaccgcggcgtgcagctg
ctggtgggcgacctcaacgccacgttgcgtcgcactcccgcgttgtatcgcggtacccat
cgcgccaaaggtttcgactggagcgtggccgacgacgcgcgcaacagcgtcttggccttc
atccgccacgatcctgacggcggcggcgtgccgctgctggcagtgagcaacctcaccgcg
caaccgctgcacgactatggcgtgggcgtgccgcgcgccggcgcctggcgcgaaatcctc
aacaccgacagtgcccattacggtggcagcaacctcggcaacagcggtcgtcttgcgact
gagccgatgggcatgcatgggcatgcgcaacgcctgcgcctgaccctgccgccgctggcc
acgatctatctgcaagcggagaaatag

DBGET integrated database retrieval system