KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0115Help
Entry
XOO0115           CDS       T00235                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO0115 (malQ)
Enzymes [BR:xoo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     XOO0115 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
110847..112958
Genome map
AA seq 703 aa AA seqDB search
MAIARRAVAHRLQCGHPGSADAAAARTRGACGKRGCRYAGIAGRWLHRLVRAAIVSTRAP
GSEDLDALAAAAGVMVDWVDASDQPRHVSEQSVHAVLTALELPAATAAQRADSLRRCQAQ
AAEPAPLLTVQVGELLPLRVAANTIGRWTDDSGASEDARTDARGQLRAPPRFGYWTLQIG
AITQHVAVAPRRCFSVADACGQASPRAWGMALQVYSARSLDDGGIGDAAGTVEWLRHATL
AGADALALSPVHASRPVTGAYSPYSPSDRRFLDPLHAAPVRILGELALDAINAVPGLRER
FDRLHDGALIDWQASAHAKWELLRQLYTRVAPDHADLVAFGNADGAALQGFARFAAQDFG
DNDPQLHVFTQWLAARSWSDAQRQAHERGMKIGLIADLAVGFDPNGAEAAAAADTVLRGL
VLGAPPDAFNADGQHWGIGAYSPTALRRSGYAPYIALLRAVLRDRGGIRIDHILGLMRLW
VVPDGASSNEGAYLAYPLHDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSRRGVMGI
DVLMFTRDDDGAFVSPALWRPDAIATTTTHDLPTLTGWREGRDIAWRRKLALIQPAQASD
DAKARIKDVARLEAAVEHAGLSSAHDPLLGALRFTAASVSPLALLPVEDALALDEQPNLP
GTVEVHPNWRRRLPDPLPHARLSSALQGFAEARRVAAVSEPHP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattgcccggcgggctgtggcacatcgccttcaatgtgggcacccaggcagtgcc
gatgccgccgctgcgcggacgcgtggcgcatgtggaaaacgtggctgccgatacgcagga
attgccggtcgatggcttcatcgcctggtacgagccgcaatcgtgagtacgcgtgccccg
ggcagtgaggacctcgacgccctggccgctgcagccggggtgatggtggattgggtggat
gccagcgaccagccgcggcatgtgtccgagcaatcggtgcatgccgtgctcaccgcgttg
gaattgcccgccgccaccgcggcgcaacgcgccgacagcctgcgccgctgccaggcacag
gccgccgagccggcgccgctgctgacggtgcaggtgggtgagttgctgccattgcgcgtg
gcagccaatacaatcggccgctggaccgacgacagcggtgccagcgaagacgcccgcaca
gatgcacgagggcaactgcgcgcgccgccgcgtttcggttactggacgctgcagatcggc
gcgatcacccagcacgtggccgtggcaccgcgccgctgtttcagcgtggccgatgcctgt
ggccaagcatcgccgcgtgcctggggcatggcgctgcaggtgtattcggcacgcagcctg
gatgacggcggtatcggcgatgctgccggcacggtggaatggctgcggcacgcgaccttg
gccggcgccgacgccctggcattgagtccggtgcacgcctcgcgcccggtgacgggcgcc
tacagcccgtattcgccgagcgatcggcgctttctcgatccgttgcatgccgcaccggtg
cgcatcctgggtgaactggcgctggatgcaatcaacgcggtgcccggtctgcgcgaacgt
ttcgatcgcctgcacgatggcgcattgatcgattggcaggcctcggcgcacgccaagtgg
gaattgctgcgccagttgtacacgcgtgttgcgcccgatcatgccgacctggtcgcattc
ggcaacgcagacggcgcggcgctgcagggctttgcacgctttgctgcgcaggatttcggc
gacaacgatccgcagttgcatgtgttcacccaatggctggcagcgcgcagctggtccgat
gcgcaacgccaggcgcacgagcgcggcatgaagatcgggttgatcgccgatctggcggtc
ggcttcgaccccaatggcgccgaagccgcagcagcagcagacaccgtgttgcgcgggctg
gtgctgggcgcgccaccggatgcgttcaatgccgatggtcagcattggggcattggcgcg
tactcgcccaccgcattgcgacgcagcggctacgcgccgtacatcgcactgctgcgcgcg
gtgttgcgcgaccgtggcggtatccggatcgatcacatcctgggcctgatgcggctgtgg
gtggtgcccgatggcgccagttccaacgaaggcgcgtatctggcgtacccgttgcacgat
ctgctcaatctgctcgcgctggaatcgtggcggcatcgcgcaattgtcatcggcgaggat
ctgggcgtggtgccgccgggcatccgcgaagaactgtcgcggcgtggggtcatgggcatc
gatgtgttgatgttcacccgcgacgacgacggcgcgttcgtctcgccggcgctatggcgg
ccggatgcgatcgccaccaccaccacccacgacctgcccacgctcactggctggcgcgaa
ggccgcgatatcgcatggcggcgcaagctggcattgatccagcctgcgcaggccagcgat
gacgccaaagcgcgcatcaaggacgtggcacggctggaagccgctgtcgaacacgccggc
ctgagcagtgcgcatgacccgctgctgggcgcattgcgtttcaccgccgccagcgtctcg
ccactggctttgttgccggtggaggatgcgctggcgctggacgaacaacccaatctgccg
ggcaccgtcgaagtgcatcccaactggcgtcgacgcctgcccgatcccttgccgcatgcg
cgcctgagttcggcgctgcagggctttgccgaggcgcgtcgcgtcgcggccgtttcggaa
ccgcatccatga

DBGET integrated database retrieval system