KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0115Help
Entry
XOO0115           CDS       T00235                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xoo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
111009..112958
Genome map
AA seq 649 aa AA seqDB search
MSTRAPGSEDLDALAAAAGVMVDWVDASDQPRHVSEQSVHAVLTALELPAATAAQRADSL
RRCQAQAAEPAPLLTVQVGELLPLRVAANTIGRWTDDSGASEDARTDARGQLRAPPRFGY
WTLQIGAITQHVAVAPRRCFSVADACGQASPRAWGMALQVYSARSLDDGGIGDAAGTVEW
LRHATLAGADALALSPVHASRPVTGAYSPYSPSDRRFLDPLHAAPVRILGELALDAINAV
PGLRERFDRLHDGALIDWQASAHAKWELLRQLYTRVAPDHADLVAFGNADGAALQGFARF
AAQDFGDNDPQLHVFTQWLAARSWSDAQRQAHERGMKIGLIADLAVGFDPNGAEAAAAAD
TVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAPYIALLRAVLRDRGGIRIDHIL
GLMRLWVVPDGASSNEGAYLAYPLHDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSR
RGVMGIDVLMFTRDDDGAFVSPALWRPDAIATTTTHDLPTLTGWREGRDIAWRRKLALIQ
PAQASDDAKARIKDVARLEAAVEHAGLSSAHDPLLGALRFTAASVSPLALLPVEDALALD
EQPNLPGTVEVHPNWRRRLPDPLPHARLSSALQGFAEARRVAAVSEPHP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgcgtgccccgggcagtgaggacctcgacgccctggccgctgcagccggggtg
atggtggattgggtggatgccagcgaccagccgcggcatgtgtccgagcaatcggtgcat
gccgtgctcaccgcgttggaattgcccgccgccaccgcggcgcaacgcgccgacagcctg
cgccgctgccaggcacaggccgccgagccggcgccgctgctgacggtgcaggtgggtgag
ttgctgccattgcgcgtggcagccaatacaatcggccgctggaccgacgacagcggtgcc
agcgaagacgcccgcacagatgcacgagggcaactgcgcgcgccgccgcgtttcggttac
tggacgctgcagatcggcgcgatcacccagcacgtggccgtggcaccgcgccgctgtttc
agcgtggccgatgcctgtggccaagcatcgccgcgtgcctggggcatggcgctgcaggtg
tattcggcacgcagcctggatgacggcggtatcggcgatgctgccggcacggtggaatgg
ctgcggcacgcgaccttggccggcgccgacgccctggcattgagtccggtgcacgcctcg
cgcccggtgacgggcgcctacagcccgtattcgccgagcgatcggcgctttctcgatccg
ttgcatgccgcaccggtgcgcatcctgggtgaactggcgctggatgcaatcaacgcggtg
cccggtctgcgcgaacgtttcgatcgcctgcacgatggcgcattgatcgattggcaggcc
tcggcgcacgccaagtgggaattgctgcgccagttgtacacgcgtgttgcgcccgatcat
gccgacctggtcgcattcggcaacgcagacggcgcggcgctgcagggctttgcacgcttt
gctgcgcaggatttcggcgacaacgatccgcagttgcatgtgttcacccaatggctggca
gcgcgcagctggtccgatgcgcaacgccaggcgcacgagcgcggcatgaagatcgggttg
atcgccgatctggcggtcggcttcgaccccaatggcgccgaagccgcagcagcagcagac
accgtgttgcgcgggctggtgctgggcgcgccaccggatgcgttcaatgccgatggtcag
cattggggcattggcgcgtactcgcccaccgcattgcgacgcagcggctacgcgccgtac
atcgcactgctgcgcgcggtgttgcgcgaccgtggcggtatccggatcgatcacatcctg
ggcctgatgcggctgtgggtggtgcccgatggcgccagttccaacgaaggcgcgtatctg
gcgtacccgttgcacgatctgctcaatctgctcgcgctggaatcgtggcggcatcgcgca
attgtcatcggcgaggatctgggcgtggtgccgccgggcatccgcgaagaactgtcgcgg
cgtggggtcatgggcatcgatgtgttgatgttcacccgcgacgacgacggcgcgttcgtc
tcgccggcgctatggcggccggatgcgatcgccaccaccaccacccacgacctgcccacg
ctcactggctggcgcgaaggccgcgatatcgcatggcggcgcaagctggcattgatccag
cctgcgcaggccagcgatgacgccaaagcgcgcatcaaggacgtggcacggctggaagcc
gctgtcgaacacgccggcctgagcagtgcgcatgacccgctgctgggcgcattgcgtttc
accgccgccagcgtctcgccactggctttgttgccggtggaggatgcgctggcgctggac
gaacaacccaatctgccgggcaccgtcgaagtgcatcccaactggcgtcgacgcctgccc
gatcccttgccgcatgcgcgcctgagttcggcgctgcagggctttgccgaggcgcgtcgc
gtcgcggccgtttcggaaccgcatccatga

DBGET integrated database retrieval system