KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0119Help
Entry
XOO0119           CDS       T00235                                 

Gene name
mauG
Definition
methylamine utilization protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     XOO0119 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(119494..120555)
Genome map
AA seq 353 aa AA seqDB search
MKSSKMSRQIIISIFLTVVLLLLGVRWLAGLDLDQGERRQATVALGNTLFQDTTLSARRT
LACSSCHDPSKAFAQDIAVPIVYGQRTGTRNVPSLLDLPYFTHFFWDGREEKLERVAVAA
FTNQAEMAQPDMSVLIKAVSQRLDYRTQFKAAFGDERVDQERISSAILAYLASVTTGRSR
YDAFVAGNTTALTTAERRGLDVFRGKADCSSCHALNGTPAAFTDNRFHHSNVGMDRMAGQ
ISTTIESFKTKREQGVPVAELVLSDPDMAALGRFAISGQGNDLAAYRTPTLRNVTRTPPY
MHDGSVQNLEEAIQREIYYRSLSRGTPISLTAGEKNDLYAFLHALEDLPNNAH
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcaagcaaaatgtcgcgacaaatcatcatctccatcttcttgaccgtcgtattg
cttttgctgggcgtacgttggctggcgggattggatctggatcaaggagagcgccgtcaa
gccacggtagccctgggtaacaccctgttccaggacaccactctcagcgcgcgtcggacc
ctggcctgcagctcgtgccacgatccaagcaaggcattcgcccaagacatcgcagtcccc
attgtctatggtcagaggaccggcacccggaacgtaccaagcttattggaccttccttac
ttcactcatttcttctgggatggtcgcgaggaaaaactggagcgagtagcggtggcggcc
ttcaccaatcaggccgaaatggctcaaccggatatgagtgtgttgatcaaggcggtgtca
caacggctggattatcgaactcaattcaaggcagcgtttggcgatgagcgggtcgatcag
gaacgtatctctagtgccatcttggcttacttggcgtccgttacgactggtcgcagccgg
tacgacgctttcgtcgcgggaaacaccaccgccttgacaacggcagagcgccgcggcctg
gatgtgttccgcgggaaagccgactgctcttcatgccatgccttaaacggtactccagcc
gctttcacggacaaccgatttcaccattccaacgtcgggatggatcggatggctggacaa
atcagcactaccattgaatcttttaaaaccaaacgcgagcagggtgttccagtcgctgag
ctcgtactgtcagatccagacatggccgcactgggacgatttgcaatcagcggccaaggc
aatgacttggcggcataccgaaccccaaccttacgcaacgtcacccgtacgccaccctac
atgcacgatggcagcgtgcaaaaccttgaagaggcgatccagcgcgagatctattaccgc
agtctttcgcgcggcactcctatctcattgacggcaggagaaaagaatgatctgtacgca
ttcctgcatgcgcttgaagacctgcccaacaacgctcattaa

DBGET integrated database retrieval system