KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0194Help
Entry
XOO0194           CDS       T00235                                 

Gene name
glgB1
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO0194 (glgB1)
Enzymes [BR:xoo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     XOO0194 (glgB1)
Exosome [BR:xoo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOO0194 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(197425..199623)
Genome map
AA seq 732 aa AA seqDB search
MMSGVMTAVSNRWDPGVIRALAEARHGDAFAVLGAHRTDTGRVLRTYLPGAERVSAVLDD
GQTIALEAGPEPGLFAGDLPAQGGYRLRIGWPGGEQDTADPYAFGPQLSDFDLHLISEGH
HLQLADALGANVVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQSGVWEL
FVPDVGPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPYQWSDDGWMAT
RARRQAHDAPMSVYEMHAGSWLREEGVDLDWDGLADHLIPYVADMGFTHVELMPVTEHPF
GGSWGYQPLGLFAPTARFGTPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGT
ALYEHADPREGFHRDWNTLIYNHGRREVSGFLIASAMEFLQRYHVDGLRVDAVASMLYRD
YSRNAGEWVPNIHGGRENYETIAFLRRLNALVREHTPGAVMIAEESTAFPGVTADVAHGG
LGFHYKWNMGWMHDTLHYASLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGS
LLGRMPGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDSGLPWHLLDDPRH
RGVQTLVRDVNRLYVQYPALHAHDDDPSGFAWVVGDDAGNSVVAFLRKGKRGDAPVLVVI
NFTPVVQHGYRIGVPQGGQWREVFNSDAGIYGGANLGNGGIVTAEQQSMHGHAHALPLLL
PPLGAIVLTPPG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtggagtaatgacagcagtgagtaatcgatgggatcccggcgtcatccgtgcc
ctggccgaggcgcgccacggcgatgcgttcgccgtcctgggcgcgcaccgaaccgacacc
ggacgtgtattgcgcacctatttgcctggcgccgagcgcgtcagcgcggtgctggacgac
ggccagacgatcgcgctggaggctggcccggagccgggcctgtttgccggcgaccttccg
gcgcagggcgggtatcggctgcgcatcggctggcccggtggcgagcaggacaccgccgac
ccgtacgcgttcggtccgcaactgagcgacttcgacctgcacctgatcagcgaaggccac
cacttgcaattggccgacgcgctgggcgccaacgtggtggaagtggacggcgtacgcggc
acgcgctttgcggtgtgggcgccgaatgcctcgcgtgttgcggtggtgggcgacttcaac
agctgggacgcgcgccgtcatccgatgcggctgcggcaccagtccggcgtgtgggagttg
ttcgtgcccgacgtcggccccggtgcgcattacaagtaccagctgcgtggcccgcatggg
cacgaactgccggccaaggccgacccggtggcgcgccgcgcagagcttgcgccgggcacc
gcctcgatcgtggccgaccccacgccgtatcagtggagcgacgacggctggatggcgacg
cgcgcgcgtcgtcaggcgcacgacgcgccgatgagcgtctacgagatgcatgccggctcc
tggctgcgcgaagaaggcgtggatctggactgggatggtctggccgatcacttgattccc
tatgtggccgatatgggctttacccatgtcgagttgatgccggtgaccgagcatccgttc
ggcggctcgtggggctatcaaccgttgggcctgttcgcgcctaccgcgcgcttcggcacg
cccgacggtttcgcgcgttttgtggaccgctgccaccgcgaaggcattggtgtgatcgtc
gactgggtgcctgcgcactttcccaccgacgcgcacggcctggcgcatttcgatggcacc
gcgctgtacgaacatgccgacccgcgcgagggtttccatcgcgactggaatacgctgatc
tacaaccacggccgtcgtgaggtgtccgggttcctgatcgccagtgcgatggaatttctg
cagcgctaccacgtcgatggtctgcgcgtggatgcggtggcttcgatgctgtaccgcgat
tacagccgcaatgccggcgagtgggttcccaacatccacggcggccgcgagaactacgag
accatcgcgttcctgcgccggctcaacgcgctggtgcgcgagcacactccgggcgcggtg
atgattgccgaagaatccaccgcgtttcctggcgtcaccgccgatgtggcgcatggcggc
ctgggcttccactacaagtggaacatgggctggatgcacgacacgctgcattacgccagt
ctggacccgatctatcgccgttaccaccatggcgagctgacgttcagcatggtctacgcg
tattcggagcgcttcgtgctgccgatctcgcacgacgaagtggtgcacggcaaggggtcg
ttgctgggccgcatgccgggcgacgactggcagcgctttgccaatctgcgcgcgtatctg
ggtttcatgttcacccacccggggcgcaagttgctgttcatgggctgcgagttcggccag
ccgaccgagtggaaccacgacagcggtctgccgtggcacttgttggacgatccacgccac
cgtggcgtacagacgctggtgcgcgacgtgaaccggctgtatgtccaataccctgcgctg
catgcgcatgacgacgacccgtcaggcttcgcctgggtggtgggcgacgatgccggcaac
agcgtggtggcattcttgcgcaagggcaaacgtggcgatgcgcccgtgctggtggtgatc
aatttcaccccggtcgtgcagcacggctatcgcatcggcgtgccacaaggcggccagtgg
cgcgaggtattcaatagcgacgccggcatttatggcggtgcgaacctgggcaatggtggc
atcgtcacggcagagcagcagtccatgcacggccacgcacacgcgctgccgctcttgttg
cccccactgggcgcgatcgtgctcacgccgcccggctga

DBGET integrated database retrieval system