KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0282Help
Entry
XOO0282           CDS       T00235                                 

Gene name
egl
Definition
(GenBank) cellulase
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XOO0282 (egl)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XOO0282 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
291788..292921
Genome map
AA seq 377 aa AA seqDB search
MLSHIERSCPYSARRPCTGLSHAQEFAMPSPHTRTRRPRCRALSLLLLAAMPLAQAQGTY
GLKYAGVNLSGAEVNSSQQPGVLDIDYHYPAADEYTYFAGKYMNTVRLPILWERLQPKPG
GQLDPAQLALIREAVANAKAAKMYLIVDVHNYAKYYGHTIGSTNVPIRTFNDLWRRLAIA
FKSDKAVIFGLMNEPHDIEPQAWATAAQASIDTIRKTGATNLILVPGALWTGAHSWYSTV
AGQSNAVAMASIHDPLNRYAIEAHQYLDADSSGTSGACVSATVGVERLRSFTQWLRLNGK
RGFLGEFGTGKTVTCNLALKGMLGYMESNSDVWMGWAYWAAGTWWNRGYPFNVQPDAQGR
DKPQMSILSQQAHRITD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtcgcacatcgaacgttcatgcccttactcagcgcgtcgtccttgcacaggtctt
tcgcacgcacaggagtttgccatgccatcccctcacacccgtacgcgccggccgcgttgc
cgcgcgctgtctttgttattgctggccgccatgccgctcgcgcaggcgcaaggcacttat
ggcctgaaatatgcaggcgtcaatctatccggcgccgaggtcaattcctcgcaacagccc
ggcgtactcgacatcgactatcactatccggcggccgacgaatacacctatttcgccggc
aagtacatgaacaccgtgcgcttgccgatcctatgggaacggctgcagccaaagccgggc
ggccagctggacccggcgcagctggcgttgatccgggaggcggtcgccaacgccaaggcg
gccaaaatgtacttaatcgtggatgtgcacaactacgccaagtattacggccacaccatc
ggcagcacgaacgtgccgatcaggaccttcaacgatttgtggcgacggctggcgatcgcc
ttcaagagcgacaaggccgtgatattcgggctgatgaatgagcctcacgacatagaaccg
caagcgtgggcgacggccgcgcaggcgtcgatcgacaccattcgtaaaaccggcgccacc
aatctgattctggtgccgggtgcgttatggacaggcgcgcacagctggtactccacggta
gctgggcaatccaatgcagtggcgatggcatccattcacgatccgctcaatcgttatgcg
atcgaggcacatcaatatttggatgccgattccagcggtaccagcggcgcttgcgtcagc
gccacggtcggggtcgagcgcttgcgcagcttcacccaatggctgcgtctaaacggaaaa
cgcgggtttctcggcgaatttggtaccggcaagacggtcacctgcaatctcgcgctcaag
ggcatgctgggctacatggaatctaacagtgacgtgtggatgggatgggcctactgggca
gcaggcacctggtggaacagggggtatccgttcaatgtgcaaccggatgcgcaggggcgc
gacaagccgcagatgtccatattgagccagcaggcgcaccggattaccgattaa

DBGET integrated database retrieval system