KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0288Help
Entry
XOO0288           CDS       T00235                                 

Gene name
MltB
Definition
(GenBank) Membrane-bound lytic murein transglycosylase B
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO0288 (MltB)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XOO0288 (MltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
296965..299283
Genome map
AA seq 772 aa AA seqDB search
MSRSKPQAAPNTHPPSPSCTPVASQVGYPRRLDLPRRRTPPHDVRPPAGHRAMTLPRRAL
PLVLGLLPLAACADPAFDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVLPLLDAQPE
FTTPIWDYLASLVDNQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVT
GKRPLLVSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPST
YTRIAVDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVTLPRGFDASKAGRT
RRQPLQAWQTAGLLGTDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYDAIYAYNAA
ESYALSIALLADRLRGGPGLIATWPTDDPGLGRPERRELQQLLLARGYQIGEADGMVGSA
TRRAIQVEQIRLGLQPADGRPGQRILTALRAAPPLAGVAAVRATAFKLPTAYPAFAQSAI
VHKASPMSDTTGLTTGDFHGFPSLLIETPFSTAAISLFGGQLVSFVPKGGQDVMWLSPLA
KQPPTPIRGGAPVCWPYFGRQGQIGDVPAHGFVRTVAWRLTESRREDDGTVVLTLTPPRL
DDLALRLRMTLRIGRTLEQRLITENTSAAPVRFTQALHNYFRVGDALKISVQGLDGLDYL
DKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRIVIATEGSRSLV
AWNPGEEAGKKMADVGDGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgctctaagccgcaagcagcacctaatacgcatcctccatcgccatcctgcacg
cctgtcgccagccaggttggctatcctcggcggctcgacttgccgcgcaggagaactcca
ccgcatgacgtccgcccacctgccggccatcgcgccatgacgctgccccggcgcgcattg
ccgttggtgctgggactgctgccactggccgcctgcgccgatcccgccttcgaccgctgc
ctggctggcctgcagacccaggccgctgccaagggcgtggaccctgcaggctttcagcgt
ttcaccgccgggctggtgcctgatcccagcgtgttgccgctgctggatgcacagcccgaa
ttcaccacgccgatctgggattacctggccagcttggtcgataaccagcgcgtgaccgat
ggccaggccatgctggtcacccaccgcgcgctgttgactcgcctgtccgaacaaaccggc
gtggacccggccaccatcgtggcggtgtggggcgtggagagcgactacggccgcgtcacc
ggcaagcgcccgctgctggtgtcgctggccacgctgtcgtgtgcaggccgccgccagccg
ttcttccgtgacgaattcctcgccttgctcagcctgctgcaacgaggcgatctggctgcg
gatgggctgaccggctcctgggccggcgcattcgggcagacccagttcatgccctcgacc
tacacccgcatcgcggtggatggcgacggcgacggccgccgcgatctggtcgccagcatt
cccgacgcactggcctcgaccgccaactatctggtcaaggccggctgggaacgcgcccgc
ccgtggggcatggaagtcacgctgccgcgcgggttcgatgccagcaaggccggccgcacc
cgccgccaaccgctgcaggcctggcaaaccgccggcctgctcggcaccgacggcaaaccg
ctggcaccgatcgggttgccggcggagacccccgccgccttgctgctgccggccggcgcc
accggcccggcgttcctggtgttccgcaactacgacgccatttatgcttacaacgccgcc
gaaagttacgcgctgtccatcgccctgctcgccgaccgcctgcgcggcggccccggcctg
attgccacctggcccaccgacgacccgggcctggggcggcccgaacggcgcgaactgcag
cagttgctgctcgcccgcggctaccagatcggcgaggccgacggcatggtcggcagcgcc
acccgccgtgccatccaggtcgagcagatccgcctgggcctgcaaccggccgacggccgt
cccggccaacgcatcctcaccgccctgcgcgccgcgccgccgctcgccggcgttgcggcc
gttcgcgccaccgccttcaagctgccgaccgcatacccggccttcgcccaatccgccatc
gtccataaggcatcccccatgtccgacaccaccggcctgaccacaggcgatttccacggc
tttccatcgctgctgatcgaaacgccgttctccaccgcggccatcagcctgttcggcggg
caactcgtgtcgttcgtgcccaagggcggccaagacgtgatgtggctgtcgccgctcgcc
aagcagccgcccaccccgatccgcggtggtgcgccggtgtgctggccgtatttcggtcgc
cagggccagatcggcgatgtccccgcccacggcttcgtccgcaccgtggcctggcgactc
accgaaagccgccgcgaagacgacggcaccgtggtgctcacgctcaccccgccgcgcttg
gacgacctggcgttgcgcctgcgcatgacgctgcgcatcggccgcacgcttgagcaacgc
ctgatcactgaaaacaccagcgccgccccggtgcgtttcacccaggcgctgcacaactat
ttccgcgtcggcgacgcgctgaagatcagcgtgcagggcctggatggcctggactacctc
gataaatacgagaactacgctaccgcacaccgtcagcaaggcgactggagcctgcgcgac
ccacgcgatcccggccgcagcgaccgtatctacaccaatgccggtggccgctacacgctc
accgacccggtgctcggccgccgcatcgtcatcgccaccgaaggcagccgctcgctggtg
gcttggaatccgggcgaagaggccggcaagaagatggccgacgtgggcgacggctggcgc
gactacgtctgcctggaagcggccaacgccggcccggatgtgatcgaactcgcccccggc
gccagccacaccctgacccagaccatcagtgtcgagtaa

DBGET integrated database retrieval system