KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0402Help
Entry
XOO0402           CDS       T00235                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XOO0402 (hemB)
Enzymes [BR:xoo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     XOO0402 (hemB)
Exosome [BR:xoo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOO0402 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
409017..409952
Genome map
AA seq 311 aa AA seqDB search
MMRENTLTTDDLIWPVFVHALSGRAPIASMPGVERLSLEELLREAENALELGIPVMDLFP
VIDPAGKSLDAAEAWNPDGLAQRAVRALKSRFPELGVMTDVALDPYTTHGQDGIIDDKGY
VLNEITVEALVKQSLSHAQAGVDIISPSDMMDGRIGAIRRALDADDHLNVRIMAYSAKYA
SAFYGPFRDAVGSAGNLGKADKTTYQMDPANGDEALREIALDLEEGADMVMVKPGMPYLD
VLRRVKEQFRVPTFAYQVSGEYAMLKAASANGWLDERKCVLEALMAFKRAGADGVLTYFA
PQVARWLRETR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgcgaaaacacgctgaccaccgatgacctgatctggccggtgttcgtgcacgcc
ttgtccggccgcgcgccgattgcgtcgatgccgggcgtggaacgcctgtcgctggaggag
ttgctgcgcgaagcggaaaacgcgctggaactgggcatcccggtgatggatctgtttccg
gtcatcgacccggccggcaagagcctggacgctgccgaagcctggaacccggacggcctg
gcgcagcgcgcggtacgtgcgttgaagtcgcgctttccggagcttggggtgatgaccgac
gtggcgctggacccgtacaccacccacgggcaggacggcatcatcgatgacaagggctat
gtgctcaacgagatcaccgtcgaggccctggtcaagcaatcgttgtcgcatgcgcaggcg
ggcgtggacatcatttcgccttcggacatgatggacggccgcatcggtgcgatccgccgc
gcgctcgatgccgacgatcatctcaacgtgcggatcatggcgtattcggccaagtatgcc
tcggcgttctacggcccgttccgcgatgccgtgggcagcgccggcaatcttggcaaggcc
gacaagaccacctatcaaatggacccggccaacggtgacgaagccttgcgcgagatcgcc
ctggatctggaagaaggcgcggacatggtgatggtcaagccgggcatgccgtatctggat
gtgctgcgccgggtgaaggaacaattccgcgtgccgacctttgcgtatcaggtcagcggc
gagtacgcgatgctcaaggcggcctcggccaatggctggctggatgagcgcaagtgcgtg
ctcgaggcgttgatggccttcaagcgtgccggtgccgatggcgtgctgacctatttcgcc
ccgcaagtggcgcgctggttgcgggaaacgcgctga

DBGET integrated database retrieval system