KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0402Help
Entry
XOO0402           CDS       T00235                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xoo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
408960..409952
Genome map
AA seq 330 aa AA seqDB search
MAHPHYRPRRMRHDAFSRRLMRENTLTTDDLIWPVFVHALSGRAPIASMPGVERLSLEEL
LREAENALELGIPVMDLFPVIDPAGKSLDAAEAWNPDGLAQRAVRALKSRFPELGVMTDV
ALDPYTTHGQDGIIDDKGYVLNEITVEALVKQSLSHAQAGVDIISPSDMMDGRIGAIRRA
LDADDHLNVRIMAYSAKYASAFYGPFRDAVGSAGNLGKADKTTYQMDPANGDEALREIAL
DLEEGADMVMVKPGMPYLDVLRRVKEQFRVPTFAYQVSGEYAMLKAASANGWLDERKCVL
EALMAFKRAGADGVLTYFAPQVARWLRETR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcccacccgcactatcgtccccgccgcatgcgccacgatgcgttttcgcgccggttg
atgcgcgaaaacacgctgaccaccgatgacctgatctggccggtgttcgtgcacgccttg
tccggccgcgcgccgattgcgtcgatgccgggcgtggaacgcctgtcgctggaggagttg
ctgcgcgaagcggaaaacgcgctggaactgggcatcccggtgatggatctgtttccggtc
atcgacccggccggcaagagcctggacgctgccgaagcctggaacccggacggcctggcg
cagcgcgcggtacgtgcgttgaagtcgcgctttccggagcttggggtgatgaccgacgtg
gcgctggacccgtacaccacccacgggcaggacggcatcatcgatgacaagggctatgtg
ctcaacgagatcaccgtcgaggccctggtcaagcaatcgttgtcgcatgcgcaggcgggc
gtggacatcatttcgccttcggacatgatggacggccgcatcggtgcgatccgccgcgcg
ctcgatgccgacgatcatctcaacgtgcggatcatggcgtattcggccaagtatgcctcg
gcgttctacggcccgttccgcgatgccgtgggcagcgccggcaatcttggcaaggccgac
aagaccacctatcaaatggacccggccaacggtgacgaagccttgcgcgagatcgccctg
gatctggaagaaggcgcggacatggtgatggtcaagccgggcatgccgtatctggatgtg
ctgcgccgggtgaaggaacaattccgcgtgccgacctttgcgtatcaggtcagcggcgag
tacgcgatgctcaaggcggcctcggccaatggctggctggatgagcgcaagtgcgtgctc
gaggcgttgatggccttcaagcgtgccggtgccgatggcgtgctgacctatttcgccccg
caagtggcgcgctggttgcgggaaacgcgctga

DBGET integrated database retrieval system