KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0435Help
Entry
XOO0435           CDS       T00235                                 

Gene name
argI
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO0435 (argI)
  Amino acid metabolism
   00220 Arginine biosynthesis
    XOO0435 (argI)
   00330 Arginine and proline metabolism
    XOO0435 (argI)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XOO0435 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442136..443149
Genome map
AA seq 337 aa AA seqDB search
MARPMPCCAAARHGAGVPLECSVLSILEQCMATQYVPVSLIGVPTDIGAGHRGARMGPEA
LRIAGLHEALVGRGVEVRDLGNLDGPRNPWQAPQAGYRHLDEVVAWNQALMGASYAELRA
GRMPIMLGGDHCLGIGSITAVAKYCREQGRPLRVLWLDAHSDFNTSEVTPSGNVHGMPVA
CLCGLGPETLTHLGGSAPALLPEQVRQIGIRSVDPEEKRLIKQHRIDVYDMRYIDEAGMK
RTMEAALQDMSADTHLHVSFDVDFLDPSIAPGVGTTVPGGPNYREAQLVMEMIADTGRMG
SLDIVELNPVLDNRNATAELAVDLVESLFGKSTLMRD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcccatgccgtgttgcgctgctgcgcgtcacggtgcgggcgtaccactagaa
tgctcggttttatcgatactggagcaatgcatggcaacgcagtacgtgccggtttccctg
attggcgttcccaccgacatcggcgccggccaccgcggcgcgcgcatgggaccggaggcg
ctacgcatcgccggactgcacgaggccctggtcggccgcggtgtggaggtgcgcgacctg
ggcaacctggatggcccgcgcaatccctggcaggcaccgcaagccggctaccggcatctg
gacgaagtggtggcctggaaccaggcgctgatgggcgccagctacgccgaactgcgtgcc
ggacgcatgccgatcatgctcggtggcgaccattgcctgggcatcggctccatcaccgcg
gtggccaagtactgccgcgagcagggccggccgttgcgggtgctgtggctggatgcgcac
tcggacttcaacaccagcgaggtgacgccctcgggcaatgtgcacggcatgccggtggcc
tgtctgtgcgggctgggcccggagacgctgacccatctgggcggcagtgcgccggcgctg
ttgcccgagcaggtacggcagatcggcatccgctcggtggacccggaggagaagcggctg
atcaagcagcaccgcatcgatgtctacgacatgcgctacatcgacgaagccggcatgaag
cgcaccatggaggccgcgttgcaggacatgagtgccgacacgcacctgcatgtgagcttc
gatgtggacttcctcgaccccagcatcgcgccgggcgtgggcaccaccgtgcccggtggc
cccaactaccgcgaggcgcagctggtgatggagatgatcgccgacaccgggcgcatgggg
tcgttggacatcgtcgagctcaacccggtgctggacaaccgcaacgcgaccgccgaactg
gcggtggatctggtcgaaagcctgttcggcaaatcgacgctgatgcgggattga

DBGET integrated database retrieval system