KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0498Help
Entry
XOO0498           CDS       T00235                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO0498 (algC)
   00030 Pentose phosphate pathway
    XOO0498 (algC)
   00051 Fructose and mannose metabolism
    XOO0498 (algC)
   00052 Galactose metabolism
    XOO0498 (algC)
   00500 Starch and sucrose metabolism
    XOO0498 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    XOO0498 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    XOO0498 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOO0498 (algC)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XOO0498 (algC)
    5.4.2.8  phosphomannomutase
     XOO0498 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
516515..517909
Genome map
AA seq 464 aa AA seqDB search
MQIATEMFRAYDIRGVVGKDLNPGVAALIGQAIGSVMQAQGLRHVVVGRDGRLSGPELTN
GLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHNPPDYNGFKIVIGGETL
SGTAIAELHQRINEGRLHTAATPGELEQRDISDAYIQRIADDVQLDRPIKVVVDAGNGVA
GEIAPRLLEAIGAKVVPLYCDIDGTFPNHHPDPSEPHNLDDLVRMVQRFDADIGVAFDGD
ADRLGVVTKEGTVVFPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGGSPLMW
KTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAARLLEIFAQSEQTPSEVL
DALPESVSTPEIKVPVEGDAHALVARFVERAQTGGESPFESARLSTIDGLRADFVDGWGL
IRASNTTPILVLRFEADSEAALQRIRTLFREELQALVPAHPLAF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcgccaccgagatgttccgcgcctacgacatccgtggtgtggtcggcaaagac
ctcaaccccggcgttgccgccttgatcggccaggccatcggcagcgtgatgcaggcgcag
ggcctgcgccatgtggtggtcggccgcgacggccggctgtccggaccggagttgaccaat
ggcctgatcgaaggcctgcgccgcgccggctgcaatgtcaccgacatcggcttggcgccg
acgccggtggtgtacttcggcgcgtacgagctgcgtgccggcagctgcgtggcggtgacc
ggcagccacaatccgccggactacaacggcttcaagatcgtgatcggcggcgagaccttg
tccggcaccgccattgccgaattgcaccagcgcatcaacgaaggccgcctgcataccgct
gccacgcccggcgaactggagcagcgcgacatcagcgatgcctacatccagcgcattgcc
gacgacgtgcagcttgatcgcccgatcaaggtggtggtggacgccggcaacggcgtcgcc
ggtgagatcgcgccgcgccttctggaagcgatcggcgccaaagtggttccgttgtattgc
gatatcgacggcacttttcccaatcatcaccccgacccgagcgagccgcacaacctcgac
gatctggtgaggatggtgcagcgtttcgatgcggatatcggcgtggcgttcgatggcgac
gccgatcgcctgggcgtggtcaccaaggaaggcacggtggtgttccccgaccgcctgctg
atgctgttcgccgccgatgtgctgcagcgcaatcccggcgcgttggtcatctacgacgtg
aaatgcaccggcaagctgtccgactacgtgttgcgtaatggcggcagcccgttgatgtgg
aagaccgggcattcgctgatcaaatccaagatgcgcgagaccgacgccgaactggctggc
gagatgagcgggcacttcttcttcaaggagcgctggtacggcttcgacgacggcatctac
gccgctgcacgcttgctggaaattttcgcccagagcgagcagaccccgtccgaggtattg
gacgccttgcccgaaagcgtctccacgccggagatcaaggtgccggtggagggcgatgcg
catgcgctggtcgcgcgttttgtcgagcgtgcgcagaccggcggagaatcgccgttcgag
tcggcacggctgtcgaccatcgatggcttgagggcggatttcgtcgatggctggggcctg
atacgcgcttccaacaccacgccgatcctggtgctgcggttcgaagccgacagcgaggct
gcattgcagcggattcgcacgctgttccgcgaggaactgcaggcgttggtgcctgcgcat
cccttggcgttctga

DBGET integrated database retrieval system