KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0644Help
Entry
XOO0644           CDS       T00235                                 

Gene name
cheR
Definition
methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xoo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xoo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
665623..667332
Genome map
AA seq 569 aa AA seqDB search
MTDDEISSTETAPDIATQPPLFVLGVGAARLDAGRLAELLDAVAGAANLAIMLLLRDRQL
LDEAHLRALLGKQATLLSVPFDGEKLQPGRFYLPPADTVVTLEEGRIRLRALPNGESDHG
LIDSFFVSMAHDQDGNVIGLIMGRFDGDGTLGTAAIKECGGLALAVDDASLHGLDLRSAS
NPAAITDHILPLPQLTARIAAHMQRHHGFGHPGPLGVRNGSESDKLSQIAAILRNTTGHD
FHGYKRATFLRRVQQRMQVAQVEMLEQYLHILRYRFDEPLQLFNDLLIGVTKFFRDRRGF
ELLEQQVIPRLFKGKHTDDSMRVWVLGCSTGEEAYSLAMLLREHAETLDSAPRIQIFASD
IDGRALATARVGRYASSIVGEVALERLRRWFVKEGDTYVVNKELRELCVFSQHSIVKDPP
FSRLDLVSCRNLLIYLDAELQNRVIPIFHFAIRPGGYLFLGNAENVSLQAQLFTPVDRSV
RVFQRLDAQSNVHATFPTMQPAAAARVPARPQRQRTSSSALVSAGERIADCYAPTYAVLD
EHFEVLHVSSQAGRFIRPAALRQASICSI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgaaatttccagcaccgagaccgcccctgacatcgccacgcagccgccc
ttattcgtgctgggcgtgggcgccgcgcggcttgatgcaggccgcttggcggaattgctc
gatgcggtagcaggcgctgcgaatctggcgatcatgctgctgctgcgcgatcgccagttg
ctggacgaggcgcacctgcgcgcattgcttggtaaacaagccacgctgttgtcggtgccc
ttcgatggcgagaaattgcagccggggcgcttctatctaccgcctgccgataccgtggtc
acgctggaggaagggcgtatccgcctgcgggcattgcccaacggcgaaagcgaccacggg
ttgatcgacagtttcttcgtgtcgatggcgcacgatcaggacggcaatgtgatcggtctg
atcatggggcgtttcgatggcgacggcacgttgggcacggcagcgatcaaggaatgcggc
ggcctggcgctggcagtggacgatgcctcgctgcatgggctggatctgcgcagcgccagc
aatccggctgccatcactgaccacatcctgccgctgccacaattgactgcacgcatcgct
gcgcacatgcagcgtcaccacggcttcggtcatccgggaccgctgggcgtgcgcaatggc
agcgagagcgacaagctcagccagattgccgcgatcctgcgcaataccaccggccacgat
tttcacggttacaaacgcgccacgttcctgcgtcgcgtgcagcagcgcatgcaggtcgcg
caggtggaaatgctggagcagtatctgcacatcctgcgctaccgcttcgacgagccgttg
cagctgttcaacgacctgctgatcggcgtgaccaagttttttcgcgaccgccgcggattc
gaattgctcgagcagcaggtgatcccgcggttgtttaagggcaagcacaccgacgacagc
atgcgcgtctgggtgctgggttgctccaccggcgaagaagcctattcgctggcgatgctg
ctgcgcgagcatgccgaaaccctggacagcgcgccacgtatccagatcttcgccagcgat
atcgacgggcgtgcgctggccaccgcgcgggtggggcgctatgcctccagcatcgtgggc
gaggttgcgcttgagcgcttgcggcgctggttcgtcaaggaaggcgacacctatgtggtg
aacaaggaactgcgcgagctgtgcgtgttctcccagcacagtatcgtcaaggatccgccg
ttttcgcggctggatctggtctcgtgccgcaatctgctgatctatctggatgccgaattg
cagaatcgggtcatcccgatctttcatttcgccatccgcccgggcggctatctgtttttg
ggcaatgcggaaaacgtctcgctgcaggcgcagttgtttacgccggtggaccgcagcgtt
cgggtgtttcaacggctcgatgcgcaaagcaacgtacacgccaccttcccgaccatgcag
ccggcggcggccgcccgggtgccggcacggccgcagcggcagcgcacttccagtagtgcg
ctggtgagtgcgggcgagcgcatcgccgactgctatgcgcccacctacgcggtgctggac
gagcatttcgaagtgttgcatgtctcttcgcaggccgggcgcttcatccgtccggcggcg
ttacgccaagcctcaatttgctcaatctga

DBGET integrated database retrieval system