KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0644Help
Entry
XOO0644           CDS       T00235                                 

Gene name
cheR
Definition
(GenBank) methyltransferase
  KO
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOO0644 (cheR)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XOO0644 (cheR)
Enzymes [BR:xoo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     XOO0644 (cheR)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XOO0644 (cheR)
Two-component system [BR:xoo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   XOO0644 (cheR)
Bacterial motility proteins [BR:xoo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XOO0644 (cheR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
665518..667332
Genome map
AA seq 604 aa AA seqDB search
MHTGVGRQVLHGGLPCFEQSSPIAPELSVANDSAAMTDDEISSTETAPDIATQPPLFVLG
VGAARLDAGRLAELLDAVAGAANLAIMLLLRDRQLLDEAHLRALLGKQATLLSVPFDGEK
LQPGRFYLPPADTVVTLEEGRIRLRALPNGESDHGLIDSFFVSMAHDQDGNVIGLIMGRF
DGDGTLGTAAIKECGGLALAVDDASLHGLDLRSASNPAAITDHILPLPQLTARIAAHMQR
HHGFGHPGPLGVRNGSESDKLSQIAAILRNTTGHDFHGYKRATFLRRVQQRMQVAQVEML
EQYLHILRYRFDEPLQLFNDLLIGVTKFFRDRRGFELLEQQVIPRLFKGKHTDDSMRVWV
LGCSTGEEAYSLAMLLREHAETLDSAPRIQIFASDIDGRALATARVGRYASSIVGEVALE
RLRRWFVKEGDTYVVNKELRELCVFSQHSIVKDPPFSRLDLVSCRNLLIYLDAELQNRVI
PIFHFAIRPGGYLFLGNAENVSLQAQLFTPVDRSVRVFQRLDAQSNVHATFPTMQPAAAA
RVPARPQRQRTSSSALVSAGERIADCYAPTYAVLDEHFEVLHVSSQAGRFIRPAALRQAS
ICSI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgcatacaggcgttgggagacaagtgctgcatggcggtctgccgtgctttgagcaatca
tcgccgattgcgcctgagctcagcgttgcgaacgatagtgccgccatgaccgacgacgaa
atttccagcaccgagaccgcccctgacatcgccacgcagccgcccttattcgtgctgggc
gtgggcgccgcgcggcttgatgcaggccgcttggcggaattgctcgatgcggtagcaggc
gctgcgaatctggcgatcatgctgctgctgcgcgatcgccagttgctggacgaggcgcac
ctgcgcgcattgcttggtaaacaagccacgctgttgtcggtgcccttcgatggcgagaaa
ttgcagccggggcgcttctatctaccgcctgccgataccgtggtcacgctggaggaaggg
cgtatccgcctgcgggcattgcccaacggcgaaagcgaccacgggttgatcgacagtttc
ttcgtgtcgatggcgcacgatcaggacggcaatgtgatcggtctgatcatggggcgtttc
gatggcgacggcacgttgggcacggcagcgatcaaggaatgcggcggcctggcgctggca
gtggacgatgcctcgctgcatgggctggatctgcgcagcgccagcaatccggctgccatc
actgaccacatcctgccgctgccacaattgactgcacgcatcgctgcgcacatgcagcgt
caccacggcttcggtcatccgggaccgctgggcgtgcgcaatggcagcgagagcgacaag
ctcagccagattgccgcgatcctgcgcaataccaccggccacgattttcacggttacaaa
cgcgccacgttcctgcgtcgcgtgcagcagcgcatgcaggtcgcgcaggtggaaatgctg
gagcagtatctgcacatcctgcgctaccgcttcgacgagccgttgcagctgttcaacgac
ctgctgatcggcgtgaccaagttttttcgcgaccgccgcggattcgaattgctcgagcag
caggtgatcccgcggttgtttaagggcaagcacaccgacgacagcatgcgcgtctgggtg
ctgggttgctccaccggcgaagaagcctattcgctggcgatgctgctgcgcgagcatgcc
gaaaccctggacagcgcgccacgtatccagatcttcgccagcgatatcgacgggcgtgcg
ctggccaccgcgcgggtggggcgctatgcctccagcatcgtgggcgaggttgcgcttgag
cgcttgcggcgctggttcgtcaaggaaggcgacacctatgtggtgaacaaggaactgcgc
gagctgtgcgtgttctcccagcacagtatcgtcaaggatccgccgttttcgcggctggat
ctggtctcgtgccgcaatctgctgatctatctggatgccgaattgcagaatcgggtcatc
ccgatctttcatttcgccatccgcccgggcggctatctgtttttgggcaatgcggaaaac
gtctcgctgcaggcgcagttgtttacgccggtggaccgcagcgttcgggtgtttcaacgg
ctcgatgcgcaaagcaacgtacacgccaccttcccgaccatgcagccggcggcggccgcc
cgggtgccggcacggccgcagcggcagcgcacttccagtagtgcgctggtgagtgcgggc
gagcgcatcgccgactgctatgcgcccacctacgcggtgctggacgagcatttcgaagtg
ttgcatgtctcttcgcaggccgggcgcttcatccgtccggcggcgttacgccaagcctca
atttgctcaatctga

DBGET integrated database retrieval system