KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0720Help
Entry
XOO0720           CDS       T00235                                 

Gene name
phdB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:xoo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xoo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:xoo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xoo00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
738563..740356
Genome map
AA seq 597 aa AA seqDB search
MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKATMEVPSSVSGVVKEI
KVKLGDSLSQGALVALIEVADAGVDAGAAAAAKPAAAAAAPAAPAKAAPASAPAPAAKAE
AAAPAASSNGGLTEARVPDIGDYTDIPVIEVLVAVGDTVAKDQSLVTLESDKATMEVPSS
AAGVVKELKVKVGDLLSQGSVVAIIAASDGGAGAAQSSVKPTTDTAETAGKVEPVAVPAE
PDKLAQREIAQVQGARSGAAAQSAQVSQPSAGNPSSPPVTFDADSVLPSKVPYASPVVRV
FARELGVDLNQLKGSEKGGRITREDVQRFVKAALSGGAPAAAGAVPAGGANGLNLLAWPK
VDFSKFGETETQPLSRIKKISGANLARNWAMIPHVTQFESADITDLEALRVALNKENEKA
GIKLTMLAFLVKASAAALKTFPEFNASLDAAGENLTLKKYINIGFAADTPNGLVVPVIRD
VDKKGVLQIAQESGELAKKARDGKLGPADMSGGCFSISSLGGIGGTAFTPIINAPEVAIL
GVSKSAMQPVWNGKEFVPKLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaggaagcacttgtccccgatatcggtgactacagcgacgtcccggta
atcgaggtgctggtgtccgtcggcgatacggtcagcaaggaccagagcctggtcacgctg
gaatcggacaaggccaccatggaagtgccgtcgtcggtgtccggcgtggtcaaggagatc
aaggtgaagctgggtgattcgctctcgcagggcgcgctggtggcattgatcgaagtggcc
gatgccggcgtcgatgccggcgctgctgctgcagccaagcccgcagctgctgctgctgcg
cccgccgcgccggccaaggccgctcctgcgtctgccccggcacccgcggccaaggccgaa
gccgctgcgcctgctgcctcctcgaacggcggcctgaccgaagcgcgcgtgcccgatatc
ggcgattacaccgacatcccggtgatcgaagtgctggtcgctgtcggcgataccgtcgcc
aaggaccagagcctggtcaccctggaatcggacaaggccacgatggaagtgccgtcctcg
gcggccggcgtggtcaaggagctcaaggtcaaggtcggcgacctgctctcgcagggcagt
gtggtggcaatcattgcagccagcgatggcggtgcgggggcggcgcagtcgtccgtcaag
cccaccaccgacaccgccgagacggcgggcaaggtcgagccggtcgccgtgccggccgag
ccggacaagctggcccagcgcgaaattgcgcaggtgcagggcgcccgttccggcgcagct
gcgcagtccgcgcaggtcagccagccgtcggccggcaacccgagcagcccgccggtgacc
ttcgatgccgacagcgtgctgccgtccaaggtgccgtacgccagcccggtggtgcgcgtg
ttcgcacgcgaactgggcgtagacctgaaccagctcaagggcagtgaaaagggcggccgc
atcacccgcgaagacgtgcagcgctttgtgaaggcggcactcagcggcggcgcacctgcc
gccgccggcgctgtgccggccggtggcgccaacggcctgaacctgctggcctggccgaag
gtggacttcagcaagttcggcgagaccgaaacccagccgctgtcgcgcatcaagaagatt
tccggagccaacctggcgcgcaactgggccatgattccgcacgtcacccagttcgagtcg
gccgacatcaccgacctggaagccctgcgcgtggccctcaacaaggaaaacgagaaggcg
ggcatcaagctcaccatgctcgccttcctggtcaaggccagcgccgcggcgttgaagacg
ttccccgagttcaacgcctcgctggatgcggccggcgaaaacctcacgctgaagaagtac
atcaacatcggcttcgcggccgatacaccgaatggcctggtggtgccggtgatccgcgac
gtcgacaagaagggcgtgctgcagatcgcgcaggaaagcggcgaactggccaagaaggcg
cgcgacggcaagctgggtccggccgacatgagcggcggctgcttctcgatcagctcgctc
ggcggcatcggcggtaccgcgttcacgccgatcatcaatgcgccggaagtggcgatcctg
ggcgtgtccaagtcggcgatgcagccggtctggaacggcaaggagttcgtgcccaagctg
atgctgccgttgtcgctgagctacgaccaccgggtcatcgacggcgcgctggcggcccgt
ttcaccacctacctcagccaggtgctggccgacatgcgtcgcgtcctgctgtga

DBGET integrated database retrieval system