KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0720Help
Entry
XOO0720           CDS       T00235                                 

Gene name
phdB
Definition
(GenBank) dihydrolipoamide acetyltranferase
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO0720 (phdB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO0720 (phdB)
   00020 Citrate cycle (TCA cycle)
    XOO0720 (phdB)
   00620 Pyruvate metabolism
    XOO0720 (phdB)
Enzymes [BR:xoo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XOO0720 (phdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
738437..740356
Genome map
AA seq 639 aa AA seqDB search
MHARMRALHPAGRAIFARQWLALRPAAGHNRGFPILLPEFPRMAEIKEALVPDIGDYSDV
PVIEVLVSVGDTVSKDQSLVTLESDKATMEVPSSVSGVVKEIKVKLGDSLSQGALVALIE
VADAGVDAGAAAAAKPAAAAAAPAAPAKAAPASAPAPAAKAEAAAPAASSNGGLTEARVP
DIGDYTDIPVIEVLVAVGDTVAKDQSLVTLESDKATMEVPSSAAGVVKELKVKVGDLLSQ
GSVVAIIAASDGGAGAAQSSVKPTTDTAETAGKVEPVAVPAEPDKLAQREIAQVQGARSG
AAAQSAQVSQPSAGNPSSPPVTFDADSVLPSKVPYASPVVRVFARELGVDLNQLKGSEKG
GRITREDVQRFVKAALSGGAPAAAGAVPAGGANGLNLLAWPKVDFSKFGETETQPLSRIK
KISGANLARNWAMIPHVTQFESADITDLEALRVALNKENEKAGIKLTMLAFLVKASAAAL
KTFPEFNASLDAAGENLTLKKYINIGFAADTPNGLVVPVIRDVDKKGVLQIAQESGELAK
KARDGKLGPADMSGGCFSISSLGGIGGTAFTPIINAPEVAILGVSKSAMQPVWNGKEFVP
KLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcacgcatgcgggcactgcatcccgccggccgagcgatttttgcacggcaatgg
ttggcgctgcggcccgcagccggccacaataggggtttccccattctgttgccggagttc
ccccgtatggccgaaatcaaggaagcacttgtccccgatatcggtgactacagcgacgtc
ccggtaatcgaggtgctggtgtccgtcggcgatacggtcagcaaggaccagagcctggtc
acgctggaatcggacaaggccaccatggaagtgccgtcgtcggtgtccggcgtggtcaag
gagatcaaggtgaagctgggtgattcgctctcgcagggcgcgctggtggcattgatcgaa
gtggccgatgccggcgtcgatgccggcgctgctgctgcagccaagcccgcagctgctgct
gctgcgcccgccgcgccggccaaggccgctcctgcgtctgccccggcacccgcggccaag
gccgaagccgctgcgcctgctgcctcctcgaacggcggcctgaccgaagcgcgcgtgccc
gatatcggcgattacaccgacatcccggtgatcgaagtgctggtcgctgtcggcgatacc
gtcgccaaggaccagagcctggtcaccctggaatcggacaaggccacgatggaagtgccg
tcctcggcggccggcgtggtcaaggagctcaaggtcaaggtcggcgacctgctctcgcag
ggcagtgtggtggcaatcattgcagccagcgatggcggtgcgggggcggcgcagtcgtcc
gtcaagcccaccaccgacaccgccgagacggcgggcaaggtcgagccggtcgccgtgccg
gccgagccggacaagctggcccagcgcgaaattgcgcaggtgcagggcgcccgttccggc
gcagctgcgcagtccgcgcaggtcagccagccgtcggccggcaacccgagcagcccgccg
gtgaccttcgatgccgacagcgtgctgccgtccaaggtgccgtacgccagcccggtggtg
cgcgtgttcgcacgcgaactgggcgtagacctgaaccagctcaagggcagtgaaaagggc
ggccgcatcacccgcgaagacgtgcagcgctttgtgaaggcggcactcagcggcggcgca
cctgccgccgccggcgctgtgccggccggtggcgccaacggcctgaacctgctggcctgg
ccgaaggtggacttcagcaagttcggcgagaccgaaacccagccgctgtcgcgcatcaag
aagatttccggagccaacctggcgcgcaactgggccatgattccgcacgtcacccagttc
gagtcggccgacatcaccgacctggaagccctgcgcgtggccctcaacaaggaaaacgag
aaggcgggcatcaagctcaccatgctcgccttcctggtcaaggccagcgccgcggcgttg
aagacgttccccgagttcaacgcctcgctggatgcggccggcgaaaacctcacgctgaag
aagtacatcaacatcggcttcgcggccgatacaccgaatggcctggtggtgccggtgatc
cgcgacgtcgacaagaagggcgtgctgcagatcgcgcaggaaagcggcgaactggccaag
aaggcgcgcgacggcaagctgggtccggccgacatgagcggcggctgcttctcgatcagc
tcgctcggcggcatcggcggtaccgcgttcacgccgatcatcaatgcgccggaagtggcg
atcctgggcgtgtccaagtcggcgatgcagccggtctggaacggcaaggagttcgtgccc
aagctgatgctgccgttgtcgctgagctacgaccaccgggtcatcgacggcgcgctggcg
gcccgtttcaccacctacctcagccaggtgctggccgacatgcgtcgcgtcctgctgtga

DBGET integrated database retrieval system