KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0794Help
Entry
XOO0794           CDS       T00235                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XOO0794 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOO0794 (rmlC)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XOO0794 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809683..810240
Genome map
AA seq 185 aa AA seqDB search
MRIVETRLPGCVVIEPAVFGDERGYFFETWNAERFGQHGLPTQFVQSNVSTSAKGVLRGL
HYQWPRPQGKLVSVLEGEVYDVAVDVRHGSPNFGQWAAVVLSAENKKQFWIPEGFAHGFA
VLSERAVFSYLCTDVYVKEADAGVRWDDAAIGIDWPISNPLLSAKDAAAPFLADVPAERL
PVYTP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcgtcgaaacgcgtttaccaggttgtgtcgtcatcgagccggcagtgttcggc
gatgagcgcggatatttcttcgaaacgtggaatgccgagcgcttcgggcaacatggtctg
ccgacgcagttcgtgcagagcaatgtctccacctcggccaaaggcgtgttgcgtggtttg
cattaccagtggccgcgtcctcagggcaagctggtcagcgtgctggagggtgaggtctac
gatgtggcggtcgacgtgcgccacggctcgcccaacttcgggcagtgggcggcagtggtg
ttgagcgcagaaaacaagaagcagttctggataccggaagggtttgcgcacggctttgcg
gtgctgtcggagcgagccgtgttcagttacctgtgcaccgacgtgtatgtgaaggaggcc
gatgccggcgtgcgctgggatgatgcggcgatcggtatcgattggccgatcagcaatcca
ttgctctctgcaaaggacgccgctgcgccgtttctggccgatgtgcccgctgagcgcttg
ccggtgtatacaccgtga

DBGET integrated database retrieval system