KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0797Help
Entry
XOO0797           CDS       T00235                                 

Gene name
xanA
Definition
(GenBank) phosphoglucomutase; phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00010  Glycolysis / Gluconeogenesis
xoo00030  Pentose phosphate pathway
xoo00051  Fructose and mannose metabolism
xoo00052  Galactose metabolism
xoo00230  Purine metabolism
xoo00500  Starch and sucrose metabolism
xoo00520  Amino sugar and nucleotide sugar metabolism
xoo00521  Streptomycin biosynthesis
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO0797 (xanA)
   00030 Pentose phosphate pathway
    XOO0797 (xanA)
   00051 Fructose and mannose metabolism
    XOO0797 (xanA)
   00052 Galactose metabolism
    XOO0797 (xanA)
   00500 Starch and sucrose metabolism
    XOO0797 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XOO0797 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XOO0797 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XOO0797 (xanA)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XOO0797 (xanA)
    5.4.2.8  phosphomannomutase
     XOO0797 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAW74051
UniProt: Q5H4R9
Position
complement(812712..814226)
Genome map
AA seq 504 aa AA seqDB search
MPLAAPLTSLRITALTRRCEAPILSADCSLPPVAISPHPRHGAAAKLGRPPLQDLPMTLP
AFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAGLRAS
GRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDTGLFA
IRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAGLIVD
LLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDHGADFGIAWDGDFDRCF
FFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCKSGHA
FIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEARMQK
FPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGEWRFNLRSSNTEPLLRL
NVETRGDAALLETRTQEISNLLRG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcttgccgcaccgcttacttcattgcgcatcaccgccctcacccgccgatgtgaa
gcgcccattctatccgctgactgttccctgcccccggtcgcaatttcgccacacccaaga
cacggcgcagccgctaaactcgggcgtcccccacttcaggatttgcccatgacgctaccc
gccttcaaggcctacgatattcgcggccgcgtgccggatgaactcaacgaggacttggcc
cgccgtatcggcgtggcgctggcggcgcagctggatcaggggccggtggtcctgggccac
gatgtgcgcctggcgagcccggcgttgcaggaagcgctttccgccggcctgcgtgccagc
ggccgtgacgtgatcgatatcggtctgtgcggcaccgaggaagtctatttccagaccgat
tacctcaaggccgccggcggcgtgatggtcaccgccagccacaacccgatggactacaac
ggcatgaagctggtgcgcgagcaagcgcggccgatcagctcggacaccggcctgttcgcc
atccgcgacacggtcgcggctgataccgccgcacccggcgagcccaccgccagtgagcag
agccgcaccgacaagaccgcgtacctggagcacctgctcagctacgtggaccgcagcacc
ctcaagccgctcaagctggtcgtcaacgccggcaacggcggcgccgggctgatcgtcgat
ctgctcgcgccgcatctgccgttcgaattcgtgcgcgttttccacgagcccgatggcaac
ttccccaacggcatccccaatccgctgctgccggagaaccgcgatgcgaccgccaaggca
gtcaaggaccatggcgccgatttcggcatcgcgtgggatggcgacttcgatcgctgcttc
ttcttcgatcacacaggccgcttcatcgaaggctattacctggtcggcctgcttgcccaa
gccatcctggccaaacagccgggcggcaaggtcgtgcacgacccgcgcctgacctggaac
acggtcgagcaggtcgaagaggccggcggcattccggtgctgtgcaagagcggccacgcc
ttcatcaaggaaaaaatgcgcagcgaaaatgccgtctatggcggcgaaatgagcgcgcac
cattatttccgtgagttcgcctatgccgactccggcatgattccgtggctgctgatcgca
gagctggtgtcgcagtcgggccgttcactggccgatctggtcgaagcacgcatgcagaaa
ttcccctgcagcggcgagatcaacttcaaggtcgccgatgccaaggcatcggttgcgcgc
gtgatggagcattacgcgtcgctgtctccggagctcgactacaccgacggcattagcgcc
gattttggcgaatggcgttttaatttgcgcagctccaacaccgagccgctgctgcgcctg
aacgtggaaacgcgcggcgatgccgcactgctggaaacgcgtacgcaggaaatttccaac
ctgctgcgcggctga

DBGET integrated database retrieval system