KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0832Help
Entry
XOO0832           CDS       T00235                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III holoenzyme chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00230  Purine metabolism
xoo00240  Pyrimidine metabolism
xoo01100  Metabolic pathways
xoo03030  DNA replication
xoo03430  Mismatch repair
xoo03440  Homologous recombination
Module
xoo_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XOO0832 (holC)
   00240 Pyrimidine metabolism
    XOO0832 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XOO0832 (holC)
   03430 Mismatch repair
    XOO0832 (holC)
   03440 Homologous recombination
    XOO0832 (holC)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XOO0832 (holC)
DNA replication proteins [BR:xoo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XOO0832 (holC)
DNA repair and recombination proteins [BR:xoo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     XOO0832 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi Ycf54
Motif
Other DBs
NCBI-ProteinID: AAW74086
UniProt: Q5H4N4
Position
complement(848762..849187)
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANNANLSTLILARDAEQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgcttcctcaacgaaccgctgcgg
ctggtgtgcgagctggcgcgcaaggccaacaacgccaacctgtcgacgctgatcctggcc
cgcgatgcggagcaggccgaggcgttggacgacctgctgtgggcgttcgacgacgaagcc
tacgtcccgcaccagatcgccggcaccgacgaggaagacgagctggccccggtgctgatc
gccgcccccgagttcgccgccccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtcgtgcccgccgacccggccgcccgcgaa
ccgctgcgcgagcgttggaaacagtacaaggccctgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system