KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0928Help
Entry
XOO0928           CDS       T00235                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(960079..960750)
Genome map
AA seq 223 aa AA seqDB search
MDNRTMTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIP
LSAGYKMMKPVVEGRMLQALDLQPGEDVLEVGTGSGFATACLATLAREVVSLEIDPALAA
AARANLDRTGLGSNVRIETADVFCWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVV
HGHEPVMEAVLVRGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttggataaccgcaccatgacgatcgatttcacccaggcccgcgaaaagatggttgagcag
cagatccggccgtgggacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccg
cgcgaagccttcgtgccggaggcctacaagacgctggcctatgtcgacgtggaaattccg
ctgtcggccggttacaagatgatgaagccggtcgtcgaaggccgcatgttgcaggcgctg
gatctgcagccgggcgaagacgtgctggaagtgggcactggcagcggctttgccaccgcc
tgcctggccacgctcgcgcgcgaagtcgtcagcctggagatcgacccggcgctggcggcc
gccgcacgcgccaatctggaccgtaccggcctgggtagcaatgtccgtatcgaaaccgcc
gacgtattctgctggcagagcgaacgtcgcttcgatgccatctgcgtgaccggcgcggtc
gataccctgcccgtgcagtggctgcagtggttgcgcccgaacggccggctgtttgtcgtg
cacggtcacgaaccggtgatggaagcggtcctggtccggggcgacgtcaacgccccgcgc
atcgaatcgttgttcgaaaccgacctcgcctatctccagggcgccgcaccgacgccccga
ttccagttctga

DBGET integrated database retrieval system