KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0962Help
Entry
XOO0962           CDS       T00235                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO0962 (pfkA)
   01230 Biosynthesis of amino acids
    XOO0962 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO0962 (pfkA)
   00030 Pentose phosphate pathway
    XOO0962 (pfkA)
   00051 Fructose and mannose metabolism
    XOO0962 (pfkA)
   00052 Galactose metabolism
    XOO0962 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XOO0962 (pfkA)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XOO0962 (pfkA)
Protein phosphatases and associated proteins [BR:xoo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XOO0962 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(994415..995671)
Genome map
AA seq 418 aa AA seqDB search
MITGNVLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREDLIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQTAFLAKVKQVVDKVGWCVV
VASEGIQNAHGKFVADAGGAADSFGHAQLGGVAAFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDTPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPTYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcactggcaacgtgttgtatgcccaatccggcggcgttaccgccgtcatcaacgcc
accgccgccggtgtcatcgccgaagcgcgcgcgcgcaagatcaaggtactggctgcacgc
aacggcatcctgggcgcattgcgcgaggacttgatcgacacatccaaagaatccgccgca
gccattgccgcattggcgcagacacccggcggcgcgttcggctcgtgccgctacaagctc
aaatcgttggaagaggacagcgccaagtacgagcgcctgctcgatgtgctgcgcgcgcac
gatgtgcgctggtttctctacaacggcggcaatgattcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaagcctatggctacccactgcactgcatcggcgtacccaagaccatc
gataacgacctggcggtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtccgcgaggccgccttggacgtcgccgccatggccgacacctccactaag
gtcttcatctatgaagccatgggccgccacgccggctggctggccgcagccgcaggcctt
gccgggcagggccccgacgacgcaccgcagatcatcctgctgcccgaacgcgcctacgac
cagaccgcgtttctggcaaaggtaaagcaggtagtggacaaagtcggctggtgcgtcgtg
gtagccagcgaaggcatccagaacgcgcacggcaagttcgtcgccgatgccggcggcgcg
gcggattccttcggccacgcgcagctcggcggcgtggccgcgttcctggccgcacaggtc
aagcaggaactcggctacaaggtgcactggaccttgcccgattacctgcaacgctccgca
cgccacctcgcatcgaagaccgactgggaacaggcccaagccgtcggcaaggccgccgtg
cagtacgccctcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacacc
ccctaccgctggaagatcgtacccgcgcccctgcacaaggtggccaaccacgaaaagaaa
atgccgcccagtttcctgcgcaaggacggcttcggcatcaccgagcgcgcccgccgctac
ttcgccccgttgatcaaaggcgaagcgccgctggcctacggcagcgatggtttgccgacg
tatgtgacgttgaagaatgtggcggtggcgaagaagttgccggcgtgggaggggtga

DBGET integrated database retrieval system