KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1066Help
Entry
XOO1066           CDS       T00235                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xoo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089409..1090002
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLATTLANAVEKVGHCVQCRD
FTESEICTICASSSRDRQQLCVVESPADRLAIEHATGYRGLYFVLQGRLSPLDGIGPREL
GLDRLGERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHAVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcactgctagaacaactgatcgaggccttccgggtattgcccggtgtgggccag
aagtcggcgcagcgcatggcgtatcacgtgctcgagcgcgagcgcgagggtgggcggcgt
ctggcgacgacgttggccaatgcggtggaaaaggtggggcattgcgtgcagtgccgcgac
ttcaccgagtccgagatctgcaccatttgcgccagcagcagtcgcgaccggcagcaattg
tgcgtggtcgaatcgccggccgaccgcctggcaatcgagcatgccaccggctaccgcggg
ctgtatttcgtcctgcaggggcgcctgtcgccgctggatggcatcggcccacgcgaactg
ggattggatcggctcggcgagcgtctggccgctggcgaagtgaccgaaatgatcatcgcc
accaacgccaccgtggaaggcgaggcgaccgcccattacctcgcgcagcttgcccgccag
cacgcggtacgcccgagccggcttgcccagggcatgccgctgggcggcgagctggaatac
gtggatcgcggcaccctgtcgcacgccttcggcacccgcagtgaggtgctgtga

DBGET integrated database retrieval system