KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1145Help
Entry
XOO1145           CDS       T00235                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00230  Purine metabolism
xoo01100  Metabolic pathways
Module
xoo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XOO1145 (gmk)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     XOO1145 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: AAW74399
UniProt: Q5H3S2
Position
1168875..1169486
Genome map
AA seq 203 aa AA seqDB search
MRGTLYIVAAPSGAGKSSIVNATLARDPKIALSISFTSRAPRPGERHSEHYHFVSAEEFQ
GMIAAGDFFEYALVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRQKVPDAVSVFI
LPPSRQALDERMRKRGQDSEDVMAQRLAAAREEMLHFEEFDYVIINETFDTAVSEMCAIF
TASRLRRQAQQQRHAGLIQALLD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcacactctatatcgttgcggccccttcgggcgccggcaagagcagcatcgtc
aacgccaccctggcacgcgacccgaagatcgccttgtcgatctcgttcacctcgcgcgcg
ccgcggccgggcgagcggcattccgagcactaccacttcgtctctgccgaggagtttcag
ggcatgatcgcggcgggtgatttcttcgaatacgcgctggtgcatggggactggaagggc
accgcgcggcagtcggtcgaaccgcagctggctgccggtcacgacgtcctgctggagatc
gactggcagggcgcgcgtcaggtgcgccagaaggtgcccgatgcggtcagcgtgttcatc
ctgccgccctcgcgccaggcgctggacgagcgcatgcgcaagcgcgggcaggacagcgag
gatgtgatggcgcagcgcctggccgccgcccgcgaggaaatgctgcatttcgaagagttc
gattacgtgatcatcaacgaaaccttcgacaccgcggtgtcggagatgtgcgccatcttc
accgccagccggctgcggcggcaggcgcaacagcagcggcatgccgggttgatccaggcg
ttgctggactga

DBGET integrated database retrieval system