KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1318Help
Entry
XOO1318           CDS       T00235                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00010  Glycolysis / Gluconeogenesis
xoo00052  Galactose metabolism
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO1318 (galM)
   00052 Galactose metabolism
    XOO1318 (galM)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     XOO1318 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AAW74572
UniProt: Q5H399
Position
1343992..1345161
Genome map
AA seq 389 aa AA seqDB search
MRQPPDGRRTLRRPGMCAAAWSAAASCGYARGLPSLAGRSMQRVFGQLTDGVEIHALTLR
SEAGLEAEVLTYGGILHTLQLTSARGVLPLVLNLPDLPAYAADGDSLNILVGRFGNRIAG
ARYTLDGVTHVLAANEGRNQLHGGLRGFGRRVWSVLEQAPDHVLLGYDSPDGEEGYPGNL
QVRARLQLHGLSLQLDFEAHCDAATALNLTHHPYFNLSGDPHLRAAVQVLRVPADRYLPV
DAESIPTGEIASVAGTPFDFRQPAALADNTDPAHPQVVLGKGYDQCLVLAADADCVAELY
SPHSGVALRIRSDAPAVQLYEGQHLDAHHPGLGRGVCLEPQDYPDAPNHANFPSTILRPG
ETYRRRISYHFASAGQDQPWDMVCAALEG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcagccgcccgacggccgtcgtacccttcgcaggccagggatgtgcgcagcagca
tggtcggcagccgcatcgtgcggctatgctcgcgggcttccctcattggcaggacgatcc
atgcagcgagtgttcgggcagttgacagacggtgtcgagattcatgcgctcacgctacgc
agcgaggccggtctcgaggcggaggtgctcacctatggcggcatcctgcatacgctgcag
ttgaccagcgcacggggcgtgctgcccctggtgctgaacttgccggatctgcccgcctac
gccgccgacggcgacagtctcaatatcctggtgggccgcttcggcaaccgcatcgccggt
gcgcgctacacgctggatggcgttacccacgtgctggcggccaatgaagggcgcaaccag
ttgcatggcggtctgcgcggttttgggcgacgcgtgtggagtgtgctggagcaggcgccg
gatcacgtactgctgggctacgactcgcccgatggcgaagaaggttaccccggcaatctg
caagtgcgtgcgcgcctgcagcttcacgggttgagcctgcagctggatttcgaagcgcac
tgcgacgccgctacggcgttgaaccttacccatcatccatatttcaatctgtccggcgac
ccgcacctgcgtgccgcagtgcaagtgctgcgcgtgccggccgatcgctacctgccggtg
gatgccgaatcgatcccgaccggcgagatcgcgtcggtggccggcaccccattcgatttc
cgccagcctgccgcgctcgccgataacaccgatccggcccatccgcaggtggttctcggc
aagggctacgatcagtgcttggtgctggccgccgacgcggactgcgtagccgagttgtat
tcgccgcacagtggcgtggcgctacgcatccgcagcgatgcccccgcggtgcagttgtac
gaaggccaacatctggacgcacatcatccgggactggggcgcggcgtatgcctggagccg
caggactacccggacgcgcccaatcacgccaacttcccttcgacgatcttgcggcctggg
gaaacctaccgccgccgcatcagctaccacttcgccagtgcggggcaggaccagccctgg
gacatggtgtgcgccgcactggaggggtga

DBGET integrated database retrieval system