KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1427Help
Entry
XOO1427           CDS       T00235                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xoo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xoo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455833..1456780
Genome map
AA seq 315 aa AA seqDB search
MTTMQLDSDGRLRHLLTLEGVPRTTLLQLLDRAGQIRDAAVGRVGKRSVLAGTAVCTLFF
EPSTRTRSSFHLAAQRLGADVLNFDASTSSTRKGETARDTLKNLEAMGVRGFVVRHPDDG
AVKALAAAAGEGTALINAGDGRSAHPTQGLLDMLTLRQAKGTDFSKLKVVIVGDVKHSRV
ARSDLHALRTLGAGEIRVCGPASLLPDDGILEGCVVGQDFDAMLEGADALMMLRLQRERM
EEGLVPSLEQYHTEYGLTRERLARAGHDAAVLHPGPINRGVEITDEVADGAQSCVLRQVA
NGVAVRMAVLETLLG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatgcaactcgattcggacggacgcctgcgccaccttctcaccctggaagga
gtgccgcgtaccacgctgctgcaattgctcgaccgcgccggccagatccgcgatgcggcg
gtggggcgcgtgggcaagcgcagcgtgctggcgggcaccgcggtgtgcacgctgttcttc
gaaccctccacgcgcacgcgcagttccttccatctggcggcgcagcgactgggtgcggac
gtgctcaatttcgatgcctccacctcatccacccgcaagggcgaaaccgcgcgcgacacg
ctgaagaatctcgaagcgatgggtgtgcgcggctttgtggtgcgtcaccccgacgacggc
gcggtgaaagcgctggccgccgcagcaggcgagggcaccgcgttgatcaatgccggcgac
ggacgcagcgcgcatcctacccagggcctgctcgacatgctcaccctgcgccaggccaag
ggaaccgatttttccaagctcaaggtcgtcatcgtcggcgacgtcaagcactcacgggtg
gcgcgctcggacctgcatgccctgcgcacgctgggcgctggcgaaatccgcgtctgcggc
ccggccagcctgctacctgacgacggcatactggagggctgcgtagtcggtcaggatttc
gatgccatgctcgaaggcgccgacgcgttgatgatgctgcgcctgcagcgcgagcgtatg
gaagaaggcttggtgccgtcgctggagcaatatcacaccgaatacggcctgacccgcgag
cgtcttgcgcgcgccggccatgacgctgcggtgctgcatccgggcccgatcaaccgcggc
gtggaaatcactgatgaagtggccgacggcgcgcaatcctgcgtgctgcggcaggtcgcc
aacggcgtcgccgtgcgcatggcggtactggaaacgctgctgggctaa

DBGET integrated database retrieval system