KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1427Help
Entry
XOO1427           CDS       T00235                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00240  Pyrimidine metabolism
xoo00250  Alanine, aspartate and glutamate metabolism
xoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    XOO1427 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XOO1427 (pyrB)
Enzymes [BR:xoo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     XOO1427 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AAW74681
UniProt: Q5H2Z0
Position
1455833..1456780
Genome map
AA seq 315 aa AA seqDB search
MTTMQLDSDGRLRHLLTLEGVPRTTLLQLLDRAGQIRDAAVGRVGKRSVLAGTAVCTLFF
EPSTRTRSSFHLAAQRLGADVLNFDASTSSTRKGETARDTLKNLEAMGVRGFVVRHPDDG
AVKALAAAAGEGTALINAGDGRSAHPTQGLLDMLTLRQAKGTDFSKLKVVIVGDVKHSRV
ARSDLHALRTLGAGEIRVCGPASLLPDDGILEGCVVGQDFDAMLEGADALMMLRLQRERM
EEGLVPSLEQYHTEYGLTRERLARAGHDAAVLHPGPINRGVEITDEVADGAQSCVLRQVA
NGVAVRMAVLETLLG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatgcaactcgattcggacggacgcctgcgccaccttctcaccctggaagga
gtgccgcgtaccacgctgctgcaattgctcgaccgcgccggccagatccgcgatgcggcg
gtggggcgcgtgggcaagcgcagcgtgctggcgggcaccgcggtgtgcacgctgttcttc
gaaccctccacgcgcacgcgcagttccttccatctggcggcgcagcgactgggtgcggac
gtgctcaatttcgatgcctccacctcatccacccgcaagggcgaaaccgcgcgcgacacg
ctgaagaatctcgaagcgatgggtgtgcgcggctttgtggtgcgtcaccccgacgacggc
gcggtgaaagcgctggccgccgcagcaggcgagggcaccgcgttgatcaatgccggcgac
ggacgcagcgcgcatcctacccagggcctgctcgacatgctcaccctgcgccaggccaag
ggaaccgatttttccaagctcaaggtcgtcatcgtcggcgacgtcaagcactcacgggtg
gcgcgctcggacctgcatgccctgcgcacgctgggcgctggcgaaatccgcgtctgcggc
ccggccagcctgctacctgacgacggcatactggagggctgcgtagtcggtcaggatttc
gatgccatgctcgaaggcgccgacgcgttgatgatgctgcgcctgcagcgcgagcgtatg
gaagaaggcttggtgccgtcgctggagcaatatcacaccgaatacggcctgacccgcgag
cgtcttgcgcgcgccggccatgacgctgcggtgctgcatccgggcccgatcaaccgcggc
gtggaaatcactgatgaagtggccgacggcgcgcaatcctgcgtgctgcggcaggtcgcc
aacggcgtcgccgtgcgcatggcggtactggaaacgctgctgggctaa

DBGET integrated database retrieval system