KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1523Help
Entry
XOO1523           CDS       T00235                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XOO1523
Enzymes [BR:xoo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     XOO1523
Peptidases [BR:xoo01002]
 Cysteine Peptidases
  Family C44
   XOO1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1552073..1554013
Genome map
AA seq 646 aa AA seqDB search
MCGLAGLLLASPRLHGEQLDALVRPMGAALRHRGPDDAGTWCDAQAGVALAHQRLSILDL
SPLGHQPMRSADGRYVLAYNGEVYNFAQLRAALSALGHRFRGHSDTEVLLAAVVEWGLDE
TLTRCNGMFAIALWDERDNCLFLARDRVGKKPLYYGWAGDTLVFGSELKALWQHPDFDNG
VDRNALTLLLRLGYIPAPACIHAHTFKLMPGRVLRMDAQAVAAGAAAHRADQAQQPFWNA
REAMQRALAAPFTGSDAQAEEQLDSVLRDAVALRMVADVPVGVFLSGGTDSSIVTAMMQA
QSAQPVHTFSIGFEGSHHDEAPLAREVATHLHTDHTELYVSGADALAVVPCLPDMFDEPF
ADASQVPTALVARLARGGVTVALSGDGGDELFFGYGRYQRALRNWRMHGLVPGPLRRLMA
VAARRNGESSRTGGLAALVAEAGARGIGDIYRNRISRWRDPAAVVPGATEPDSFYSLADP
LHGSGTPADAMMLADFAAYLPDDLLCKVDRTTMAVGLEARAPLLDWRVAEFAWSLPLSLK
YRDGMSKYLLKRVLCRYLPDTMVYRGKRGFGAPVSAWLRGDLHGWADDLLAHGALQREGV
FAADTVAGLWRDFNGGERKWHTHLWTVLMFQAWQAHWREQRAAITR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattggcaggactgttgctggcttcgccgcgtctgcatggcgaacagctcgat
gcgctggtgcggccgatgggcgccgctttgcgccatcgcggcccggacgatgccggcact
tggtgcgatgcgcaggccggcgttgccttggcgcatcaacggctaagcattctggatctg
tcgccgctcggccaccagccgatgcgttcggctgatggccgctatgtgctggcctataac
ggcgaggtctataacttcgcgcagctgcgcgcggcactgtccgcgctcgggcatcgcttc
cgcggccactccgataccgaagtgttgctggcggccgtggtggagtggggcctggacgag
acgttgacccgctgcaacggcatgttcgccattgcgttgtgggacgagcgcgacaactgc
ctgttcctggcgcgcgaccgggtcggcaaaaagccgctctactacgggtgggccggcgac
accttggtgttcggttccgaactcaaggccttgtggcagcacccggatttcgacaacggc
gtcgatcgcaatgcgctgaccttgctgttgcggctgggctacatcccggcgccggcctgc
atccacgcgcacaccttcaagctgatgcctggccgcgtgctgcgcatggatgcgcaggcc
gtggcggccggcgctgccgcgcatcgtgccgatcaggcgcaacaaccgttctggaacgca
cgcgaggcgatgcaacgcgcgctcgccgcaccattcaccggcagcgacgcgcaggccgaa
gagcagttggatagcgtgctgcgcgatgcggtggccctgcgcatggtggccgatgtgccg
gtgggcgtgtttctttccggtggcaccgattcgtccatcgtcactgcgatgatgcaggcg
cagagcgcgcagccggtgcacaccttcagcatcggcttcgaaggctcgcatcacgacgaa
gcgccgctggcgcgcgaagtcgccacgcatctgcacaccgaccacaccgaactctatgtc
agcggcgccgatgcgctggcggtggtgccgtgcctgccggacatgttcgacgaacccttc
gccgatgcctcgcaagtgccgacggcgttggtcgcacggttggcgcgcggtggggttacg
gtggcgctgtccggcgacggtggcgacgaattgttcttcggctatggccgctatcaacgt
gcgctgcgcaactggcgcatgcatggcctggtacctggcccgctgcgtcgcctgatggca
gtggcagcgcgtcgcaatggcgaatcttcgcgtaccggcgggctcgccgcgctggtggcc
gaggcgggcgcacgcggcatcggcgacatctaccgcaaccggatttcgcgctggcgcgac
ccggcagcggtggtgccgggggcgaccgaacccgatagtttttacagcctggccgacccg
ctgcatgggtccggcaccccggccgacgcgatgatgctggccgacttcgccgcgtatctg
cccgacgatctgctgtgcaaggtggaccgcaccacgatggcggtggggctggaggcgcgc
gcgccgctgctggattggcgcgtggccgaattcgcctggtcgctgccgctgtcgctgaaa
tatcgcgatggaatgagcaagtatctgcttaagcgcgtgttgtgccgctacctgccggac
acgatggtgtaccgcggcaagcgtggcttcggcgcgccggtgagtgcatggctacgcggc
gatctgcacggctgggcggacgatctgctggcgcacggcgcgttgcagcgcgagggcgtg
ttcgccgctgataccgtggctggcctgtggcgcgacttcaacggcggcgagcgcaaatgg
catacgcacctgtggacggtgctgatgttccaggcctggcaggcgcactggcgcgagcaa
cgcgcagccatcacgcgctga

DBGET integrated database retrieval system