KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1593Help
Entry
XOO1593           CDS       T00235                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00020  Citrate cycle (TCA cycle)
xoo00640  Propanoate metabolism
xoo00660  C5-Branched dibasic acid metabolism
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
xoo01200  Carbon metabolism
Module
xoo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xoo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XOO1593 (sucC)
   00640 Propanoate metabolism
    XOO1593 (sucC)
   00660 C5-Branched dibasic acid metabolism
    XOO1593 (sucC)
Enzymes [BR:xoo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XOO1593 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AAW74847
UniProt: Q5H2H4
Position
1634527..1635696
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPSGKVAATPDEAVDVATSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMSTYQTAGVELPINLVLVTTAGEIVKELYLSILVDRGTKT
ITYIASSEGGVEIEQVAAETPELIHALNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYKLFNEKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKQLVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
tccggcaaggtcgcggcgacaccggacgaagcggttgacgtcgccacttccctgggcaag
ggtccttggatggtgaaagcgcagatccacgcgggtggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagccaagatgctcggcaccaag
atgtccacctaccagaccgccggcgtcgagctgccgatcaacctggtgctggtgaccacg
gccggtgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctacatcgcctcaagcgaaggcggcgtggagatcgagcaggtcgcggccgaaacg
ccggagctgatccacgcgctcaacgtcgatttcgtcgaaggcgtgcagggttatcacggt
cgcgatttcggcttcaagttgggcctcaacgccaagcaggccggccagttcgctagcatc
atggtgaacttgtacaagctgttcaacgaaaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtacgcgctggatggcaagttcgacagcgacgac
aacgccgcgttccgtcagaagcagctggtcgccatgcgcgacaagacgcaggaagacgag
accgaagtgaccgcctcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgccggcctggccatggcgaccatggacgtcatcaagctcaatggc
ggcgagccggcgaacttcctggacgtgggcggcggtgcgaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgattgccgagggcatcatcgccgcggtcaaggaagtgggc
gtcaaggttccggtcgtggtgcgcctggaaggcaccaacgtggaagaaggcaagcagctg
ctgcgcgatagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaaa
gtcgttgaagctgtcaagaacgccgcctga

DBGET integrated database retrieval system