KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1661Help
Entry
XOO1661           CDS       T00235                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XOO1661 (ruvA)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XOO1661 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1724775..1725359
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYELEAPMSTFYDLPDVGRDVILFTHYAQKEDSVSL
YGFLREGERRLFRDVQKVTGIGAKIALAVLSGVTVDEFARLITSGDITALTRIPGIGKKT
AERMVVELRDRAADFSSGAPITGQLGPDAISEATVALQQLGYKPAEAARMARDAGAEGGE
VATVIRKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccgtctgcgcgggatcctggcctacaagcagccgccgtggctggtgatcgac
gtgggcggggtggggtacgagctggaggcgccgatgagcaccttctacgacctgcccgat
gtcggtcgcgacgtgatcctgtttacccattacgcgcaaaaggaagacagcgtgtcgttg
tatggcttcctgcgcgagggcgagcggcggctgttccgcgacgtgcagaaggtcaccggt
atcggtgccaagattgcgctggcggtgttgtctggcgtgaccgtggacgaattcgcccgc
ttgatcaccagtggcgacatcaccgcgctgacccgcatccccggcatcggcaagaagacg
gccgagcgcatggtggtggagctgcgcgaccgcgcggccgacttcagcagcggcgcgccg
atcaccggccaactggggccggatgccatctccgaagccaccgtggccttgcagcagttg
ggctacaagcctgccgaggctgcccgcatggcgcgcgatgccggtgcagaaggcggtgag
gtggccacggtcattcgcaaggccctgcaagccgcgctgcgctga

DBGET integrated database retrieval system