KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1781Help
Entry
XOO1781           CDS       T00235                                 

Gene name
nahA
Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XOO1781 (nahA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XOO1781 (nahA)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XOO1781 (nahA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1869269..1871803)
Genome map
AA seq 844 aa AA seqDB search
MGPSLRLPTRLCYCARLPCTAATSGCNCMMSNSAPTARPTAGAPLSSRLLALVFAATSLA
GCGQRVPGTPPAAATEGAPAAAAANTARTPLPLIPAAVEVKRGSGSFVVGTGTVISIVPG
DADARRSAEHLADLLLRTRGLRLEVRAETSASPGSIRLERSAQAPVAHKEGYSLEVDAKG
VRIAARDGAGLLYGAVSAWQLMTPDTHKGEVQLPSVAIRDWPRFSWRGQHLDVARHFHDV
DTVKHVLDTMALHKLNVLHWHLTDDQGWRIEIKRYPKLTEVGAWRTPPGAGMDGIPQRYG
GFYTQEQISEIVAYAARLHITVLPEIDMPGHAQAAVAAYPEEVGVPGVRTQVGVDWGVNP
YLFNTSERSLTFITNVLDEVLTLFPSTYIHIGGDEAVKDQWEASPAVRAQMRKLGVKDAH
AMQGWFNEQLGAYLTQHGRRMIGWDEILEGGVPASASVMSWRGVEGAVTAAKQGHDVVLA
PGDWLYLDNLQTTRNDEPNGRLTVLPLSKVYAFDPVPAGLSAEQARHVLGAQGALWSEYI
SSRWHVDHALFPRLSAVAEVTWSPKAARNWNSFLARMPAQLQRYKALGIDYSDGAFAADI
ALENGPNPVLAGGPAKVALSTQTGAGTLHYTIDGSDPTPASPRYNAPFTIQLPTTVKATA
FDANGTPLAATRSRTFDRAGLLRVDTQGLQHCVETGALGLRLPLLPEMTAADTPVYNVDL
FHACRMYPQARLDGIGAIRIDAARLPNNFGLAHEQSKVVQYPANTRGGELEVRQGCDGEL
IASVQLPRSDTLGEQFTLETALPARTGIHDLCLRFTAPIRGPLYAIGAVQLIETTAQAPP
AATR
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccgtcactgcgccttccgacacggctttgctactgtgcgcggctgccgtgtacc
gccgccacatcgggatgtaattgcatgatgtcgaactccgcacccaccgcacgcccgaca
gcaggcgcgccgttgtcctcgcgcctgcttgcgctcgtgttcgcagcaacgtcgctggcc
ggttgcggtcaacgtgtacctggcactccaccagccgccgccacggagggcgcacctgcc
gctgcagcggcaaacaccgcgcgtacaccgttgccactgattcctgcagccgtcgaggtc
aaacgcggtagtggcagcttcgtcgtgggcaccggtacggtgatctcgatcgtgcctggc
gatgccgatgcacgtcgcagtgccgaacatctggccgatctgctgctgcgcacacgcggg
ctgcgattggaagtgcgcgccgaaaccagcgcatcgccgggcagcatccgcctggagcgc
agcgcgcaggcgccggtagcgcacaaggaaggctacagcctggaggtggatgccaagggc
gtgcgcatcgccgcgcgcgatggagccggcttgttgtatggcgcagtcagcgcctggcaa
ttgatgacaccggatacgcacaagggcgaggtccaactgccgtcggtggcgatccgcgac
tggccgcgtttcagctggcgcggccagcatctggatgtggcccggcattttcatgatgtg
gacacggtcaagcatgtgctcgatacgatggccctgcacaagctcaacgtgctgcattgg
catctcaccgatgaccagggctggcgcatcgagatcaagcgctatcccaagctcacggag
gtcggtgcctggcgcacgccgccgggcgcgggaatggacggcataccgcaacgttatggc
ggcttctacacgcaggaacagatcagcgagatcgtcgcttacgccgcgcgcctgcacatc
accgtgctgccggagatcgacatgcccgggcatgcacaggcggccgttgccgcctatccc
gaagaggtgggcgtccccggtgtgcgcacccaggtgggcgtggactggggcgtcaacccg
tacctgttcaacaccagcgaacgcagcctgaccttcatcaccaatgtgctggatgaagtg
ctgaccttgttcccctcgacctacatccacatcggtggcgatgaggcggtcaaggatcaa
tgggaagcctcgccggcggtgcgcgcacagatgcgcaagctcggagtcaaggacgcgcat
gcgatgcagggctggttcaacgaacagctgggggcctacctcacccagcacggccggcgc
atgatcggctgggatgaaatcctagaaggcggcgtgccggcgagtgcgtcggtgatgtcg
tggcgcggcgtcgaaggtgcggtcactgcggccaagcaaggccacgacgtggtgcttgcg
ccgggcgactggctgtatctggacaatctgcaaaccacgcgcaacgacgaaccgaacggt
cgcctgaccgtgttgccgctgtcgaaggtctatgcattcgacccggtgccggccgggctc
agcgccgaacaggccaggcatgtgctgggcgcacaaggcgcgttgtggtccgaatacatt
tcctcgcgctggcatgtagatcacgcgctgtttccgcggctgtctgcggtggcagaagtg
acctggtcgcccaaggcggcacgcaactggaacagcttcctggcgcgtatgccggcacag
ctgcagcgctacaaggcgctgggcatcgactacagcgacggcgcattcgctgccgatatc
gcgctggaaaacggacccaacccagtgctcgccggcggcccggccaaggtggcgctgagc
acgcagactggggcgggcacgctgcactacaccatcgatggcagcgatcccacaccggca
tcgccacgctacaacgcaccgtttacgattcaattgccgaccacggtcaaggccacggcg
ttcgatgccaacggcacgccgctggcggccacgcgcagccgcacctttgatcgcgccggc
ttgttgcgcgtagacacgcaaggcttgcaacactgcgtcgaaaccggcgcactcggcttg
cgtctgccgctattgccggagatgaccgccgccgacacgccggtgtacaacgtcgatctg
ttccatgcctgccgcatgtatccgcaggcgcggctggacggcatcggcgccatccgcatc
gacgccgcacgcctgcccaataacttcggcctggcgcatgagcaatccaaggtcgtgcag
tacccggccaacacccgcggcggtgagctggaagtgcgtcagggctgcgatggcgaattg
atcgccagcgtgcagctgccgcgcagcgacaccctgggtgagcaattcacgctggaaacc
gcactgcctgcacgcaccggcatccacgatctctgcctgcgctttaccgcgccgattcgt
ggcccgttgtatgccatcggcgccgttcaactgattgaaaccaccgcgcaggcgcccccc
gccgccacgcgctga

DBGET integrated database retrieval system