KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1785Help
Entry
XOO1785           CDS       T00235                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:xoo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xoo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xoo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xoo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xoo00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:xoo00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1878412..1879512
Genome map
AA seq 366 aa AA seqDB search
MLTTLSTPFAVRRTTGDDARRRHRSGECVSASSPMEAVAFPRPETFVAADVGGTHVRLAL
VCESNDAGKPVTVLDYRKYRCAEYPGLAEIMAAFFAEVGCAPVRRGVIASAGYALDDGSV
ITANLPWVLAPEQIRRQLGMQALYLVNDFEAVAYAANYMSGNQVMQLSGPAQGAAGPALV
LGPGTGLGAALWIPHGAHPVVLPTEAGHAALAPASDLEVELLQELRRTRTHVCTETLLSG
PGLLNLYTALGALRGDAVLHANPAEITAAALAGNDALAHDALQAFCGFMGSVVGDLMLLY
GVRSGVYLAGGFLPQIAGFIAESDFVARLLDKGALRPALEQVPVSIVEHGQLGVIGAASW
FLLHGR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgctgacaacgttgtctaccccgtttgccgttcgtcggacaacgggcgacgacgccagg
cgtcgccacagatcaggagaatgcgtgagcgcaagcagtccaatggaagcggtggccttt
ccgcgccccgaaaccttcgttgccgccgatgtgggcgggacgcacgtgcgcctggcgctg
gtgtgcgaaagcaatgacgcaggcaagccagtcactgtgctggactatcgcaagtaccgt
tgcgccgagtatccgggtcttgccgagatcatggccgccttcttcgcggaggtgggctgc
gcgccggtgcgccgtggcgtgatcgccagcgccggttacgcattggacgacggcagcgtg
atcaccgccaatctgccctgggtgctggcccccgaacagattcgccgccagctgggcatg
caggccttgtatctggtcaacgatttcgaagcggtcgcctacgcggccaattacatgagc
ggcaaccaggtcatgcagttgtcgggccccgcgcaaggcgccgcgggcccggcgttggtg
ctcggtccggggacgggcctgggtgcggcgctgtggattccccacggtgcccacccggta
gtgctgccgaccgaggctggccacgcggccctggcacctgccagcgatctggaagtggaa
ctgctgcaggaactgcggcgcacgcgtacccacgtgtgcaccgagacgctgttgtccggc
ccgggcctgttgaatctgtacaccgcgctgggcgcactgcgcggcgacgctgtgctgcat
gccaaccccgccgagatcaccgctgccgcattggctggcaacgatgcactggcgcacgat
gccttgcaggcgttctgcgggttcatgggcagcgtggtcggcgacctgatgctgctgtat
ggcgtgcgtagcggtgtctatctggctggcggcttcctgccgcagatcgccggctttatc
gctgaaagcgatttcgtcgcacgcctgctcgacaagggcgcgttgcgtccggcgctggaa
caggtgccggtgagcatcgtcgagcacggccagctcggcgtcatcggtgcggccagctgg
tttctgctgcacggccgctga

DBGET integrated database retrieval system