KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1848Help
Entry
XOO1848           CDS       T00235                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO1848 (fadB)
   01212 Fatty acid metabolism
    XOO1848 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XOO1848 (fadB)
   00650 Butanoate metabolism
    XOO1848 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    XOO1848 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    XOO1848 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOO1848 (fadB)
   00310 Lysine degradation
    XOO1848 (fadB)
   00380 Tryptophan metabolism
    XOO1848 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOO1848 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOO1848 (fadB)
   00281 Geraniol degradation
    XOO1848 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XOO1848 (fadB)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XOO1848 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XOO1848 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XOO1848 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1948747..1950828)
Genome map
AA seq 693 aa AA seqDB search
MLPGFDGLRFSHWQAELREDGVVVLSLDRQDAPVNAFSQEVLLELGALVERLALEPPKGV
VLRSGKANGFIAGADLKEFQQFDHKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRVGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLSGRTVS
AKAARAIGLVDKVAAPAVLVDAAAALALAGTTRPFQQRATAWATNTLLARKILAPQMRKQ
VARKARKEHYPAPYALITVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKALGGKDAAGAAATPIRHVHVIGAGVMGGDIAAWAAYKGFDVTLQDREQRFIETALTRG
GELFAKRVKDDAKRPAVAARLRGDLAGAGVTQADLVIEAIIENPQAKRDLYQLIEPQLKP
DALLTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANAARLAAF
CKALDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELI
DTVGLDVAAGVGAELAPFLHLPIPAALITVEAGKRGKKDGQGLYTWENGRAVKPEVASGH
TAPADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQHIRSVGAD
ALLERLQALHARYGERFAPRPGWDSPVLREAVV
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgagctgcgcgaggac
ggcgtggtcgtgctcagcctcgatcgccaggacgcaccggtcaacgcattttcccaggag
gtgctgctggagttgggcgcactggtcgagcgcctggcactggagccgcccaagggcgtg
gtgctgcgctcgggcaaagccaacggtttcatcgccggtgccgatctgaaagaatttcag
caattcgaccacaagggcacggtcaacgatgcgattcatcgcgggcagcaggtctttcag
aagctggccgaactgccctgcccgaccgttgcggcgattcatggcttctgcatgggcggc
ggcaccgaaatcgcgctggcatgccgctaccgcgtggcctccgacgatggcagtacgcgc
gtcgggttgccggaaaccaagctcggcatcttccccggctggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggcggcgatggacctgatgctcagcggccgcaccgtgtcg
gccaaggctgcgcgcgcaatcggtctggtcgacaaggtcgccgcacctgcggtgctggtc
gatgcggctgcggcactggcgctcgcgggtacgacgcgtccgttccagcagcgcgccact
gcgtgggccaccaacaccttgctggcgcgcaaaatactggcgccgcagatgcgcaagcaa
gtggcccgcaaggcgcgcaaggagcattaccctgcgccatacgcgttgatcacggtgtgg
gagcgggctggcggcagcggcatccaggcccgcctggcggccgagcgcaaggcagtggtc
aagctcgccagcacgccgaccgcacgcaacctgatccgcatcttcttcctgaccgagcgt
ttgaaggcgctgggcggcaaggatgcagccggcgcggcagcgacgccgatccgccatgtg
cacgtcatcggcgctggcgtgatgggcggcgacatcgcggcgtgggcggcctacaagggc
ttcgacgtcacattgcaggaccgcgagcagcgttttatcgagacggcgctgacgcgcggc
ggcgaactgttcgccaagcgcgtcaaagacgacgccaagcggccggccgtggccgcgcgt
ctgcgcggtgacctggccggtgcgggtgtgacgcaggccgatctggtgatcgaggcgatc
atcgaaaacccgcaggccaagcgcgatctgtatcaattgatcgagccgcagctcaagccg
gatgcattgctgaccaccaatacatcttcgattccgctgaccgaactgcgtggccacatc
cagcgcccggcgcagttcgccggcctgcactatttcaacccggtggcgatgatgccgctg
gtggaaatcgtgcagcacgatggcctggatcccgccaacgcggcgcgcctggctgcattc
tgcaaggcactggacaagttcccggtgccggtggccggcacgccggggttcctggtcaac
cgggtgctgttcccgtacctgcttgaagcggccaccgcgtatgcggaaggcatacccggc
ccggtgctggacaagacggcggtgaaattcggcatgccgatggggccgatcgagttgatc
gacaccgtgggtctggacgtcgccgccggcgtgggcgcggagttggcgccgttcctgcac
ctaccgattccggcagcgctgatcacggtggaagccggcaagcgcggcaagaaggacggc
cagggcttgtacacgtgggagaatgggcgtgcggtcaaaccggaggttgccagtggccac
accgcaccggcagatctggaagacaggctgattctgccgctgctcaacgaagcggtggcg
tgtctgcacgacggcgtggtggccgacgcagacctgctcgatgccggcgtcatcttcggc
accggctttgcgcccttccgcggtggcccgatccagcacatccgcagcgtcggcgcagat
gcgctgctggaacgtttgcaggcgctgcacgcacgttatggcgaacgtttcgcaccgcgc
ccgggttgggactcgccggtgttgcgggaggcggtggtgtaa

DBGET integrated database retrieval system