KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1867Help
Entry
XOO1867           CDS       T00235                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XOO1867 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    XOO1867 (nagZ)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XOO1867 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1969695..1970780
Genome map
AA seq 361 aa AA seqDB search
MRDLTLPRASATMLRCATKAPGPGVPNMLLIGVAGTELSAQERDWLQHDAVAGVVLFKRN
FGSRSQVAELSAAIRAAAPRPVLICVDQEGGRVQRFREGFSALAPLQSFGAQYAQAPEAA
LAAARAHAQLMASEVRASGVDLSFAPVVDLGRGNRAIGDRAFSDDPQIVATFTRAYVQAL
HGAGMAATLKHFPGHGTVLEDTHVDHASDPRPLEALQAEDLVPFVAGIEAGADAVMMAHV
VYPQVAPEPAGYSQRWIEQILRGQMGFRGVVFSDDIGMAASLSAGGVAGRVHAHLDAGCD
VVLVCHPELVAESLQAVQGRRLNTAALIGLIGRGALGWDGLLAGTDASFTAPLSAHFGTT
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatctgacgctgccacgcgcatctgcgacaatgctgcgctgcgccaccaaggcg
cctggcccgggagtccccaacatgcttctgatcggcgttgccggtaccgaactcagcgca
caggaacgcgactggctacagcacgatgcggttgccggcgtggtgctgttcaagcgtaac
ttcggctcgcgcagccaggtggccgagctgtcggcggcgatccgcgcggcagcgccgcgc
ccggtgctgatctgcgtggaccaggaaggcggacgcgtgcagcggtttcgcgaaggattc
agcgcgctggcgccgttgcaaagtttcggggcgcagtacgcgcaggcccctgaggctgca
ttggctgccgcacgcgcacatgcgcagctgatggccagcgaggtccgcgccagtggtgtg
gacctgagcttcgcgccggtggtggatctaggccgcggcaatcgcgccatcggcgatcgc
gccttcagcgacgacccgcagatcgtggccaccttcacccgcgcttatgtgcaggcgctg
cacggcgccggcatggccgccacgctcaaacattttcccggccacggcaccgtgctggaa
gacacccatgtcgaccatgccagcgacccgcggccgctggaggcgttgcaggccgaagat
ctggtgccgttcgtggccggcatcgaggccggcgccgacgcggtgatgatggcgcacgtg
gtttacccccaggtggccccggaaccggctgggtattcgcagcgctggatcgaacagatc
ctgcgcggccagatgggcttccgcggcgtggtcttttccgacgatatcggcatggccgcc
tcgttgagtgccggcggcgtggcaggccgggtgcatgcgcatctggatgccggctgcgat
gtggtgttggtctgccacccggaactggtcgccgaatcgctgcaggccgtgcagggccgt
cgcctcaataccgccgcattgatcggcttgatcggccgcggcgcattgggctgggatggc
ctgctcgccggcaccgacgcgtcattcaccgctcctctttctgcccatttcggaacaact
gcctga

DBGET integrated database retrieval system