KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1917Help
Entry
XOO1917           CDS       T00235                                 

Gene name
desC
Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XOO1917 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XOO1917 (desC)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XOO1917 (desC)
Lipid biosynthesis proteins [BR:xoo01004]
 Desaturase
  First
   XOO1917 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020200..2021348)
Genome map
AA seq 382 aa AA seqDB search
MSAGGNVCAAARFIGDAKRTSPMHATIKRPGASVCRQHPYRVTITYGESRVSSTGLDPHA
AAPQPTPTPPRSGLAARIGSLRRWVDSQTDEPLDEARADRIDWLRALPFIALHLACLAVF
WVGASWFAVGMAVALYALRMFTLTGFYHRYFSHRAFKTSRVLQFVFAAIGATCVQRGPLW
WAAHHRNHHRHTDTGRDPHSPAQHGFWWSHTGWFLTPRNFRTDWDVIPDLRRFAELRFLD
RFDIVMPALLALGLYLLGDWLAVAAPALKTNGAQLLAWGFAISTVALFHATFTINSLAHR
FGSQRFDTRDDSRNNWLLALLTFGEGWHNNHHFFPGSVRQGLRWWEYDVTWYGLTAMSWV
GLVWDLKPMPKRLTQRAERVRQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgctgggggcaatgtgtgcgcagctgcgcgattcattggcgacgccaagcgaacc
tcacccatgcatgcgaccatcaagcggcccggtgcatctgtttgccggcagcatccgtat
cgggtcacgattacctatggagaatcacgcgtgtcgagtactggcttggaccctcacgcc
gcagcaccgcagcccacacccacgccaccgcgtagcgggttggccgcgcgcatcggcagc
ctgcgtcgctgggtggattcgcagaccgacgagcccctggacgaagcccgcgccgatcgc
atcgactggctgcgtgcactgcccttcattgcactgcatctggcttgcttggcggtgttc
tgggtaggcgcgtcgtggtttgcggtgggcatggcggtggcgctgtacgcattgcgcatg
ttcacgctcaccgggttttatcaccgctacttctcgcaccgtgcgttcaagacctcacgg
gtgctgcaattcgtcttcgccgccatcggtgccacctgcgtgcagcgcgggccgctgtgg
tgggcggcgcatcatcgcaaccatcatcggcataccgataccggccgcgacccgcattcg
ccggcgcagcacggcttctggtggagccacaccggctggttcctgaccccacgcaatttc
cgcaccgattgggacgtgattcccgacctgcgccgctttgccgaactgcgctttctggac
cgcttcgacatcgtgatgccggcgctgctggcgctcggcctctacctgctcggcgactgg
ctggcggttgcggcgcccgcgctgaagaccaacggtgcgcaattgctggcgtggggcttt
gcgatctccaccgtggcgctgttccatgccaccttcaccatcaactccctggcgcatcgc
ttcggcagccagcgtttcgacacgcgcgacgatagccgcaacaactggctgctggcattg
cttacctttggcgaaggctggcacaacaaccaccacttcttccccggctccgtgcgccag
ggcttgcggtggtgggaatacgatgtgacctggtacgggcttaccgcgatgtcgtgggtg
gggctggtgtgggacctcaagccgatgccgaagcggctcactcagcgggccgaacgggtg
aggcaatga

DBGET integrated database retrieval system