KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2043Help
Entry
XOO2043           CDS       T00235                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00020  Citrate cycle (TCA cycle)
xoo00310  Lysine degradation
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
xoo01200  Carbon metabolism
Module
xoo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xoo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XOO2043 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XOO2043 (sucB)
Enzymes [BR:xoo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XOO2043 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF4813 SAPS
Motif
Other DBs
NCBI-ProteinID: AAW75297
UniProt: Q5H174
Position
complement(2145016..2146218)
Genome map
AA seq 400 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKPGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPADEKKAAAPAAAAPAAAPAAAAAPAPASKSAADS
LPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVPMTRVR
KTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKAAANA
LQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVTPVLRNVERQSFADVEQGIADYAAK
ARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHTIKERPIAENGQVVIA
PMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaagcccggcgaagcggtcaagcgcgacgagaatctggtcgacctggaa
accgacaaggtcgtgttggaagttccgtcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagattctggcgatcatcgaagaaggcgct
gtggctgcggctgcaccggcggacgagaagaaggccgccgcaccggcagcagcagctcca
gctgccgcgccggctgccgccgctgcaccggcgcctgcgtccaagtctgctgccgattcc
ctgccgccgggtgcgcgtttctctgcgatcacccagggtgtggatccgtcgcaggtcgag
ggcacaggccgtcgtggcgcggtgaccaaggaagacatcgtcaacttcgccaaggccggc
ggcgtgggcaaggcctcgggcgcccgcccggaagagcgcgtgccgatgacccgcgtgcgc
aagacgattgccaagcgcctgatggagtccaagaactccaccgcgatgctgaccaccttc
aacgaggtcaacctggccaaggtatcggccgcacgcaaggaactgcaggacgaattccag
aaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggccgccgccaacgcg
ctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatcatctatcacggc
tacagcgacatctcgatcgcggtgtcgaccgacaagggcctggtcacgccggtgctgcgt
aacgttgagcgccagtcgttcgccgatgtcgaacagggcatcgccgattacgccgccaag
gcacgcgccggcaagctgggcctggatgacctgcagggcggcacctttaccatcaccaat
ggcggcaccttcggctcgctgctgtccaccccgatcatcaacccgccgcagagcgccatc
ctgggcatgcacacgatcaaggaacgcccgatcgccgagaatggccaggtcgtgatcgcc
ccgatgatgtatctggcgctgtcttacgaccaccgcatcatcgatggcaaggattcggtg
cagttcctggtcgacatcaagaaccagctggaaaacccgggccgcatgctgttcggtctg
taa

DBGET integrated database retrieval system