KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2048Help
Entry
XOO2048           CDS       T00235                                 

Gene name
purB
Definition
adenylosuccinate lyase (EC:4.3.2.2)
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xoo00230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xoo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2153324..2154691)
Genome map
AA seq 455 aa AA seqDB search
MSDSALLALSPLDGRYASKVDALRPIFSEYGLIKARVKVEIEWLLALAAEPGIAELAPFS
AAATQRLRALADGFNVAHAARVKEIERTTNHDVKAVEYFIKEQLKDDAELGPALEFVHFA
CTSEDINNLSYGLMLEQARREVLLPSLDGITAALRTLAHAQAAQPMLSRTHGQSASPTTL
GKEIANVVARLERQRKQIAAVELTGKINGAVGNYNAHLVAYPDLDWAAFAQRFVESLGLV
FNPYTTQIEPHDNVAEIGDASRRVNTILIDLARDIWGYISLGYFKQKLKEGEVGSSTMPH
KVNPIDFENAEGNFGIANALFEHFSAKLPISRWQRDLTDSTVLRALGTAFGHTQVALDSL
AKGLGKLTVNPERLDADLDAAWEVLAEAVQTVMRRHGLPNPYEQLKALTRGQGITAVSMQ
AFVESLPLPEDDKQRLRALTPGAYTGLAEQLARAI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattccgccctgctcgccctgtccccgctcgacggccgctacgcctccaaagtg
gatgcgctgcgcccgatcttctccgaatacggcctgatcaaggcgcgggtcaaggtcgaa
atcgaatggctgctggcactggccgccgagccgggcatcgccgagctggcgccgttctcg
gccgctgccacgcagcgcctgcgcgccctggccgacggcttcaacgttgcccatgcagcg
cgggtcaaggagatcgagcgcaccaccaaccatgacgtcaaggcggtggaatacttcatc
aaggagcagctcaaggacgacgccgagctgggtccggcgctggaattcgtgcactttgcc
tgcaccagcgaagacatcaataacctcagctacggcctgatgctggagcaggcgcgccgc
gaggtgttgttgcccagcctggacggcattaccgccgcgttgcgcacccttgcccacgcc
caggccgcccagccgatgctttcgcgtacccacggccagagcgcctcgcccaccacgctg
ggcaaggagatcgccaatgtggtagcgcgccttgaacgtcagcgcaagcagatcgcggcg
gtggagctgaccggcaagatcaatggcgcggtgggtaattacaacgcgcatctggtcgcc
tacccggacctggactgggctgcattcgcgcagcgtttcgtggaaagcctgggcctggtg
ttcaacccctacaccacacagatcgagccgcacgacaatgtggccgaaatcggcgatgcc
agccgtcgcgtcaataccatcctgatcgacctggcacgcgacatctggggctatatctcg
ctgggctatttcaagcagaagctgaaggaaggcgaagtcggttcctcgaccatgccgcac
aaggtcaaccccatcgacttcgaaaatgccgaaggcaatttcggcatcgccaacgcgctg
ttcgaacacttttccgccaagttgccgatcagccgctggcagcgcgacctcaccgattcc
accgtgctgcgcgcgctcggcaccgccttcggccacacccaggtcgcgctggattcgctg
gccaagggcctgggcaaactgaccgtcaaccccgagcgtctggatgccgatctggatgcg
gcctgggaagtgctggccgaagccgtgcagacggtgatgcgtcgccatggtctgcccaat
ccgtacgaacaactcaaggcgctgacccgcggccagggcatcaccgccgtctcgatgcag
gccttcgtggaaagcctgccattgccggaagacgacaagcagcgcctgcgcgcgctcact
ccgggtgcctacaccggcctggccgagcagctggcgcgcgcgatctga

DBGET integrated database retrieval system