KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2064Help
Entry
XOO2064           CDS       T00235                                 

Gene name
btuE
Definition
vitamin B12 uptake ABC transporter permease
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XOO2064 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOO2064 (btuE)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XOO2064 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2165836..2166519
Genome map
AA seq 227 aa AA seqDB search
MRWITGVVLNYNTDTQAVNCLSSPTDGTPSPVRRLNYRRALLMLLNRLLVIVFIGFFAKS
AFAAGTPVLDVDYRPLAGKTPINLNLTYGGKVVMVVNTASKCGYTPQYEGLEALNQRFAS
RGFTLLGFPSNDFHGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAEATPLYQRLTQAT
GVAPGWNFHKYLIGRDGRVVAQFPSKIKPDDPSVLAAIERELKAPSR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttggataactggtgttgtattaaactacaacaccgacacgcaggcagtcaactgc
ttgtcatccccaactgatggcaccccctcaccggtgcgccgcctcaattatcgaagggcc
ttgctcatgttgctaaatcgtctattagttattgtatttattggattttttgcgaaatcc
gcgtttgccgccggcactccggtgctggatgtggactaccgcccgctggccggcaagaca
ccaatcaacctgaaccttacctacgggggcaaggtcgtcatggtggtcaataccgccagc
aagtgtggctacaccccccaatacgaaggcctggaagcgctcaatcagcgcttcgccagc
cgcggcttcaccttgctgggcttcccgtcgaacgatttccatggccaggaacccggatct
gagaaacagatccaggaattctgcacgttgacctatggcgtcaagttcccgatgtttgag
aaggtgcatgtgctgggtgcagaggcaacgccgctgtatcagcgcttgacccaagccacc
ggcgtggcgccgggctggaattttcacaagtacctgattggtcgcgatggtcgcgtggtt
gcgcagttccccagcaagatcaagccggacgatccgagcgtcctggccgcaatcgaacgc
gagctcaaggcgccgtcgcgctga

DBGET integrated database retrieval system