KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2186Help
Entry
XOO2186           CDS       T00235                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00040  Pentose and glucuronate interconversions
xoo00052  Galactose metabolism
xoo00500  Starch and sucrose metabolism
xoo00520  Amino sugar and nucleotide sugar metabolism
xoo01100  Metabolic pathways
xoo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XOO2186 (galU)
   00052 Galactose metabolism
    XOO2186 (galU)
   00500 Starch and sucrose metabolism
    XOO2186 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XOO2186 (galU)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XOO2186 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAW75440
UniProt: Q5H0T1
Position
2297328..2298221
Genome map
AA seq 297 aa AA seqDB search
MSQRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNR
YKHSIADYFDKAYELEQKLERAGKLEQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAK
AVVGDEPFAVLLPDDLMWNRGDAALTQMADVAEASGGSVIAVEDVPQEKTASYGIVSTDA
FDGRKGRITAIVEKPKPEVAPSNLAVVGRYVLSPKIFEFLEATGAGAGGEIQLTDAIAEL
LKKEQVDAFRFQGRRFDCGAHIGLIEATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgtattcgcaaggcagtatttcccgtcgcaggtcttggaacccgctttctt
ccggcaaccaagacggtgccgaaagaaatgctgccaatcatcgacaagcccttgattcag
tacgccgtcgacgaagccatccaggctggttgcgatacgttgatctttgtgaccaaccgc
tacaaacactccattgccgattacttcgacaaggcctacgagctggagcaaaagcttgag
cgtgcaggcaagttggagcagctggagctagtacgccatgcgttgccggaaggcgttcgc
gccatttttgtgacgcaggcagaagcgctcggcctaggccacgcggtgttgtgtgccaag
gccgtggtcggtgacgaaccgttcgcggtgctgctgccggacgatctgatgtggaaccgc
ggcgatgccgcgctgacccagatggccgatgttgcagaggcctccggcggcagcgtcatt
gcggtggaagatgtgccgcaggaaaagacggccagctacggcatcgtctctaccgatgca
ttcgatggccgcaagggccgcatcactgcgatcgtcgagaagcccaagccggaagtggcg
ccgagtaatctggccgtagtcggtcggtatgtgctgagcccgaagatcttcgaatttctc
gaggctaccggtgcaggcgcgggcggcgagatccagctgaccgacgcgattgccgagctg
ctgaagaaagagcaggtcgatgccttccgtttccaaggtcgccgtttcgattgcggtgcg
catatcggcctgatcgaagccaccgtgcatttcgcgctcgagcacgaaaagcatggcggc
ccagcgaaggaaatcctgcgcaacgcattggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system